You Searched For: Hytest Ltd


1,910  results were found

SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103010-122)
Supplier: Anaspec Inc
Description: Conjugates of calf intestinal alkaline phosphatase are extensively used as secondary detection reagents in ELISAs, immunohistochemical techniques and Northern, Southern and Western blot analyses


Catalog Number: (102996-368)
Supplier: Anaspec Inc
Description: This is a peptide derived from the pseudosubstrate regulatory domain of PKC α residues (19-31) with alanine being replaced with serine at position 25.
Sequence:K(Biotin)-RFARKGSLRQKNV
MW:1914.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103009-022)
Supplier: Anaspec Inc
Description: This peptide is beta-amyloid (1-42) with substitution of Phe19 to Pro. This substitution inhibits amyloid fibril formation, which is implicated in neurodegenerative diseases such as Alzheimer’s.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103010-506)
Supplier: Anaspec Inc
Description: The calpains are a family of intracellular Ca<sup>2+</sup> supdependent cysteine proteases


Catalog Number: (103010-494)
Supplier: Anaspec Inc
Description: Alkaline phosphatase is a popular enzyme conjugated with secondary antibody for ELISA


Catalog Number: (103010-900)
Supplier: Anaspec Inc
Description: DEAC, SE is an excellent blue fluorescent building block for labeling amine-containing biomolecules.


Catalog Number: (103006-888)
Supplier: Anaspec Inc
Description: Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.
Sequence:TDECELCINVACTGC (Disulfide bonds between Cys4-Cys12 and Cys7-Cys15)
MW:1569.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (103010-232)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components


Catalog Number: (103007-532)
Supplier: Anaspec Inc
Description: A peptide substrate of O-linked GlcNAc transferase (OGT), a eukaryotic glycosyltransferase that uses UDP-GlcNAc as a glycosyl donor.
Sequence:KKKYPGGSTPVSSANMM
MW:1783.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103003-204)
Supplier: Anaspec Inc
Description: The native peptide, HATPPKKKRK (cat# 60522-1), is a substrate for cyclin-dependent protein kinase 1 (CDC2; CDK1). The fluorescent and biotinylated peptides are used to develop assays for CDK1.
Sequence:HATPPKKKRK
MW:1190.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103010-230)
Supplier: Anaspec Inc
Description: MMP-1 (interstitial collagenase, fibroblast collagenase) is an extracellular protease


Catalog Number: (103003-738)
Supplier: Anaspec Inc
Description: This hypothalamic neuropeptide has been shown to regulate feeding behavior.
Sequence:Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2 (Disulfide bridge: 6-12 and 7-14)
MW:3561.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103010-880)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488 hydrazide is a carbonyl-reactive fluorescent labeling dye.


Catalog Number: (103011-014)
Supplier: Anaspec Inc
Description: Sulforhodamine 101 C2 maleimide is an excellent thiol-reactive reagent for protein modifications. It reacts with thiol compounds such as amino acid, peptides and proteins to give bright red fluorescent conjugates that have the identical fluorescent spectral properties of Texas Redâ-derived biopolymers, in particular, antibodies.


Catalog Number: (103010-412)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components


Catalog Number: (103010-688)
Supplier: Anaspec Inc
Description: AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A is a non-glycosylated cell wall protein of Staphylococcus aureus that can bind the Fc part of immunoglobulin molecule of different species with strong affinity (1-4). Protein A consists of five IgG binding domains (A, B, C, D, and E), each approximately 60 amino acids long with no cysteines present and two S. aureus cell membrane binding domains, X and M (3).
Application: Recombinant Protein A can be used for immunoprecipitation, antibodies purification, and assay development.


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
577 - 592 of 1,910
no targeter for Bottom