You Searched For: Hytest Ltd

Catalog Number: (103007-330)

Supplier: Anaspec Inc

Description: This peptide is amino acids 311 to 325 fragment of the influenza virus nucleoprotein (NP). This bona fide MHC class II restricted epitope from influenza virus was used to study the host immunoresponse during the infection. This peptide elicits the strongest gamma interferon (IFN-gamma) production in the intracellular cytokine assays. It does not stimulate CD8 T-cells in mice.
Sequence:QVYSLIRPNENPAHK
MW:1767 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103003-754)

Supplier: Anaspec Inc

Description: This is a tyrosine phosphorylated angiotensin II peptide with a substrate sequence specificity for chymase to act. This is an octapeptide hormone that is formed as a result of the action of human heart chymase, a chymotrypsin-like serine protease on the Phe-His bond of Angiotensin I. The ideal susbtrate for human heart chymase should contain this peptide sequence, and has been demonstrated that the Pro-Phe sequence in P2-P1 positions of peptide substrates is highly favored by leukocyte chymotrypsin-like proteinases such as chymases and cathepsin G.
Sequence: DRV-pY-IHPF
MW: 1126.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103010-634)

Supplier: Anaspec Inc

Description: The SensoLyte® ThT β-Amyloid (1-40) Aggregation kit provides a convenient and standard method to measure Aβ40 aggregation using Thioflavin T dye

Sale

Supplier: Anaspec Inc

Description: Fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Catalog Number: (103007-492)

Supplier: Anaspec Inc

Description: This is fragment of the myelin basic protein (MBP), which induces moderate experimental autoimmune encephalomyelitis (EAE) symptoms in immunized mice. It corresponds to amino acids 83-96 of the murine sequence (85-98 in guinea pig; 86-99 in human).
Sequence:VVHFFKNIVTPRTP
MW:1655 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103002-990)

Supplier: Anaspec Inc

Description: ERKtide is a peptide substrate for ERK2. Extracellular regulated protein kinase 2 (ERK2) is a eukaryotic protein kinase whose activity is regulated by mitogenic stimuli.
Sequence:ATGPLSPGPFGRR
MW:1312.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-118)

Supplier: Anaspec Inc

Description: This is the N-terminal fragment of b-Amyloid peptide amino acids 1 to 9. Omission of residues 1 to 9 from the full-length Alzheimer's b-Amyloid peptide 1 to 40 does not prevent the peptide from forming amyloid fibrils or eliminate fibril polymorphism. This b-Amyloid peptide fragment contains a functional B cell epitope, but lacks known T cell epitopes, which makes it an attractive candidate for the development of b-Amyloid vaccine that lacks the potential to induce autoimmune encephalitis.
Sequence: DAEFRHDSG
Molecular Weight: 1033 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103007-596)

Supplier: Anaspec Inc

Description: This is amino acids 25 to 35 fragment of beta-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm.
Sequence: HiLyte™ Fluor 488-GSNKGAIIGLM
Molecular Weight: 1416.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103008-184)

Supplier: Anaspec Inc

Description: The short peptide RGDS (Arg-Gly-Asp-Ser) is a synthetic cell adhesion factor. RGDS is known to mediate cell adhesion to several extracellular matrix components as well as cell–cell interactions. The RGDS peptide has been shown to interact directly with and activates caspases 8 and 9, which indicates an unexpected pro-apoptotic effect due to an intracellular action.
Sequence:RGDS
MW:433.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-450)

Supplier: Anaspec Inc

Description: This peptide corresponds to the GAP27 domain of connexin. Connexins, or gap junctions, are a family of structurally-related transmembrane proteins. This synthetic connexin-mimetic peptide, Gap 27, was used to evaluate the contribution of gap-junctional communication to osteoclastic bone resorption. It was concluded that gap-junctional communication is necessary for proper bone remodeling.
Sequence:SRPTEKTIFII
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103006-002)

Supplier: Anaspec Inc

Description: An ACE-2 (Angiotensin I-converting enzyme 2) fluorescent substrate. Complete hydrolysis of 0.04 mM results in a 300-fold fluorescence increase over background. Max Abs/Em=325/393 nm upon cleavage of substrate.
Sequence: Mca-APK(Dnp)
MW: 696.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103007-070)

Supplier: Anaspec Inc

Description: Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases.
This peptide is a cathepsin S substrate fluorescently labeled with AMC (Ex/Em=354 nm/442 nm). It can be used to measure cathepsin S activity.
Sequence:Ac-KQKLR-AMC
MW:871.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-512)

Supplier: Anaspec Inc

Description: This is amino acid residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
Sequence: HCLGKWLGHPDKF
MW: 1537.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103006-410)

Supplier: Anaspec Inc

Description: (Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells.
Sequence:C(Npys)rrrrrrrrr-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-792)

Supplier: Anaspec Inc

Description: Genetic transformation in Streptococcus pneumoniae, Streptococcus mitis and Streptococcus oralis is regulated by secreted peptide pheromones named the competence-stimulating peptide (CSP). Different strains and species of these bacteria produce CSP with different primary sequence. They are termed pheromones CSP-1 (EMRLSKFFRDFILQRKK), CSP-2 (EMRISRIILDFLFLRKK), CSP-153 (DKRLPYFFKHLFSNRTK), CSP-612 (ESRLSRLLRDFIFQIKQ), CSP-676 (ERRIPDVIRSLLFQKRK), and CSP-12261 (EIRQTHNIFFNFFKRR).
Sequence:EMRISRIILDFLFLRKK
MW:2178.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale