You Searched For: 6000mg


1,910  results were found

Sort Results

List View Easy View (new)
SearchResultCount:"1910"
Description: This is a short fragment of the b-Amyloid peptide containing two aromatic phenylalanine residues. Short peptide models have provided novel insight into the mechanistic issues of amyloid formation. This heptapeptide fragment has the capacity of forming typical amyloid fibrils in vitro. Aromatic interactions are important in many cases of amyloid formation.
Sequence: KLVFFAE
Molecular Weight: 853 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103007-544
Supplier: Anaspec Inc


Description: HiLyte™ Fluor 555 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates that are only slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.
Catalog Number: 103010-934
Supplier: Anaspec Inc


Description: The TCR transgenic model (BDC2.5) mimitope was used in type 1 diabetes (T1D) study. T1D is an autoimmune disease in which T cells mediate damage to pancreatic islet beta cells. T1D is caused by autoreactive T cell destruction of insulin-producing cells. BDC2.5 mimotope was utilized to support the study on antigen presentation of antigenic peptides to islet autoantigen-specific T cells.
Sequence: RTRPLWVRME
MW: 1343.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: 103007-718
Supplier: Anaspec Inc


Description: Scrambled control peptide of beta-amyloid are often used in studies to compare the effects of wild type Beta-Amyloid (1-40).
Catalog Number: 102999-804
Supplier: Anaspec Inc


Description: Type II casein kinase (CK-2) is unique among the protein kinases since it can use ATP as well as GTP as a phosphoryl donor. It is extremely sensitive to heparin inhibition and can be activated by polyamines and basic polypeptides. This peptide contains the consensus phosphorylation sequence for CK2 and can be used as the substrate for CK2 a-subunit.
Sequence:RRRDDDSDDD
MW:1264.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103003-266
Supplier: Anaspec Inc


Description: This peptide mimics the N terminus of the alpha-chain of fibrin. It binds to the 'a' polymerization pocket in the alpha-chain more tightly than a peptide corresponding to the chain native sequence GPRV. The complex between GPRP and fibrinogen causes an increased resistance to degradation by plasmin, and the polymerization reaction is depressed by the addition of excess peptide. Fibrin assembly, as well as the acceleration of the factor XIIIa reaction, can be prevented by this homologue of the natural sequence of amino acids.
Sequence:GPRP
MW:425.5 Da
%Peak area by HPLC:≥95%
Storage condition:
Catalog Number: 102999-798
Supplier: Anaspec Inc


Description: Biotin, SE is amino-reactive biotinylating reagent for peptides and proteins; it has a better avidin-binding affinity than biotin. Biotin, SE (d-Biotin-N-hydroxysuccinimide ester) contains a five-carbon spacer arm that reduces steric hindrance associated with binding four biotinylated molecules per one avidin and results in enhanced detection sensitivity.
Catalog Number: 103010-370
Supplier: Anaspec Inc


Description: This is a biotin labeled histone 3 (H3) fragment with amino acid residues 1 to 21. Lysine 9 is di-methylated.
Sequence:ARTKQTAR-K(Me2)-STGGKAPRKQLA-K(Biotin)
MW:2637.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-650
Supplier: Anaspec Inc


Description: Renin, a highly specific aspartyl protease, cleaves angiotensinogen, to yield angiotensin I
Catalog Number: 103010-526
Supplier: Anaspec Inc


Description: Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aß (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aß (1-40) without any neurotoxic effects.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Molecular Weight: 3674 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: 103003-038
Supplier: Anaspec Inc


Description: Group II of distinct 18 peptide mixtures, in combination with Group I of 180 distinct peptide mixtures (cat# 62017-1 or cat# 62017-5), obtained via positional scanning synthetic peptide combinatorial library (PS-SPCL) can provide sequence preference information of different kinases. Amount provided is 1 mg of peptide mixture x 18 vials. Sequences: Y-A-pT-X-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-pT-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-pT-X-X-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-pT-X-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-pT-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-X-S/T-pT-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-pT-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-pT-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-X-pT-A-G-K-K(LC-biotin)-NH2 Y-A-pY-X-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-pY-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-pY-X-X-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-pY-X-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-pY-S/T-X-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-X-S/T-pY-X-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-pY-X-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-pY-X-A-G-K-K(LC-biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-X-pY-A-G-K-K(LC-biotin)-NH2 X = degenerate mixture of the 17 natural amino acids excluding cysteine, serine, and threonine. LC = 'long chain' version with an additional aminohexanoic acid spacer between the biotin and lysine side chain. S/T = equimolar mixture of serine and threonine. pT is phosphothreonine, and pY is phosphotyrosine.
Catalog Number: 103007-292
Supplier: Anaspec Inc


Description: Competence stimulating peptide-1 is a 17 amino acids pheromone that is secreted by Streptococcus pneumoniae. CSP pheromone is used in-vivo for intercellular communication. This peptide activates signal transduction pathway ComABCDE, which regulates natural genetic transformation. The pheromone is ribosomally synthesized as precursor peptide. The mature pheromone is strain specific. CSP pheromone is produced by S. pneumoniae strain Rx, which is closely related to strain R6.
Sequence:EMRLSKFFRDFILQRKK
MW:2242.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103007-722
Supplier: Anaspec Inc


Description: This is amino acids 178 to 191 fragment of the proteolipid protein (PLP), an immunodominant encephalitogenic epitope in SJL mice, one of two major encephalitogenic epitopes. PLP peptide 178 to 191 was compared with another encephalitogenic peptide, 139 to 151. The day of onset of disease induced by PLP 178 to 191 was earlier, but the incidence, severity, and histologic features were indistinguishable.
Sequence: NTWTTCQSIAFPSK
MW: 1583.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: 103007-500
Supplier: Anaspec Inc


Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
This is a fluorescent (FITC)-labeled Antennapedia, Abs/Em = 493/522 nm.
Sequence:FITC-LC-RQIKIWFQNRRMKWKK-NH2
MW:2748.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 102996-458
Supplier: Anaspec Inc


Description: This is fragment of the myelin basic protein (MBP), which corresponds to amino acids 84-96 of the murine sequence (86-98 in guinea pig; 87-99 in human).
Sequence:VHFFKNIVTPRTP
MW:1555.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103004-224
Supplier: Anaspec Inc


Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (275-305) is a 31-amino acid long peptide derived from the Repeat 2 domain.
Sequence:VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS
MW:3263.77 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: 103009-738
Supplier: Anaspec Inc


449 - 464 of 1,910