You Searched For: Hytest Ltd

Catalog Number: (103006-420)

Supplier: Anaspec Inc

Description: This is a fluorescent (TAMRA)-labeled TAT peptide, Abs/Em=541/568.
Sequence: TAMRA-YGRKKRRQRRR
MW: 1972.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103003-154)

Supplier: Anaspec Inc

Description: Adrenomedullin (AM or ADM) is a 52-amino acid peptide initially isolated from pheochromyctoma, a tumor of the adrenal medulla, hence the name "Adrenomedullin." Growing evidence shows that Adrenomedullin has many biological action which includes vasodilatation, cell growth, regulation of hormone secretion, natriuresis, as well as possessing antimicrobial effects.
Sequence:YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
MW:6028.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103009-034)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (44-63) with acetylation at Lys56. Lys56 acetylation occurs during premeiotic and mitotic S phases and persists through DNA damage repair and is catalyzed by the Rtt109-Vps75 histone acetyltransferase (HAT) complex. A deficiency of acetylated Lys56 in histone H3 is implicated in spontaneous chromosome breaks during mitosis, suggesting that this modification is important for replisome integrity and DNA replication.
Sequence:GTVALREIRRYQ-K(Ac)-STELLIR
MW:2444.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-382)

Supplier: Anaspec Inc

Description: TAMRA is one of the most popular fluorophores used in various bioconjugations. 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.

Sale

Catalog Number: (103010-374)

Supplier: Anaspec Inc

Description: Fluorescein isothiocyanate (FITC) remains one of the most popular fluorescent labeling reagents, probably due to the low cost of the material. 5-FITC and 6-FITC have very similar absorption and fluorescence spectra. However, the isomers may differ in their binding and reactivity to proteins, and the conjugates may elute under different chromatographic conditions or migrate differently in electrophoretic gels.

Sale

Catalog Number: (103009-350)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-23) with deimination at Arg3. It contains a C-terminal GGK linker with biotinylation on the side chain of this Lys. Deimination of Arg3 to Cit is carried out by peptidylarginine deiminase (PADI)-4. Although the function of deimination is not clearly known, it has been shown to inhibit Arg methylation and repress nuclear hormone receptor-dependent gene activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-Cit-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2830.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-132)

Supplier: Anaspec Inc

Description: Central to the execution phase of apoptosis are the two closely related caspase-3 and caspase-7

Sale

Catalog Number: (103003-278)

Supplier: Anaspec Inc

Description: This peptide is an H2-Db-restricted epitope from the Influenza A/PR/8/34 nucleoprotein.
Sequence:ASNENMETM
MW:1027.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103005-896)

Supplier: Anaspec Inc

Description: This peptide is derived from the carboxyl terminus of moth MCC (88-103) and pigeon cytochrome c plays a major role in T-cell selection. MCC (88-103) can induce positive selection of TCR transgenic thymocytes
Sequence:ANERADLIAYLKQATK
MW:1805.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102999-606)

Supplier: Anaspec Inc

Description: Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103010-390)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-14 (MT1-MMP), membrane-type MMP, plays an important role in tumor invasion. MMP-14 is expressed on the surface of invasive tumor cells, in stromal cells of human colon, breast, and head and neck carcinomas. MMP-14 is secreted as zymogen with a prodomain, a catalytic domain, a hinge region, a hemopexin-like domain, and a transmembrane domain. It can activate pro-MMP-23 and degrade a variety of substrates, including fibrillar collagens I, II, III, fibronectin, vitronectin and laminin-1.

A truncated human MMP-14 with His-tag was expressed in E. coli. The Mr on SDS-PAGE is 31-kDa. Incubation with 1 mM APMA at 37°C for 2 hr will activate MMP-14. Its activity can be measured by FRET peptides

Sale

Catalog Number: (103006-666)

Supplier: Anaspec Inc

Description: This peptide corresponds to amino acids 4 to 18 of rat atrial natriuretic peptide (ANP). It has been used as a cystein containing peptide model in quantitative mass spectroscopic analysis. This fragment is also related to C-ANP (4-23);  (Des-Gln18,des-Ser19,des-Gly20,22,des-Leu21), which is completely selective in discriminating rat C-AMP receptors.
Sequence:RSSCFGGRIDRIGAC-NH2 (Disulfide bridge 4-15)
MW:1594.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103010-890)

Supplier: Anaspec Inc

Description: 7-Hydroxycoumarin-3-carboxylic acid is one of the most popular blue fluorophores for labeling proteins and nucleic acids mostly through the in situ formation of its succinimidyl ester (81206). This coumarin is also increasingly used to label peptides, nucleotides and carbohydrates.

Sale

Catalog Number: (103011-004)

Supplier: Anaspec Inc

Description: Tetramethylrhodamine-6 C2 maleimide is a good alternative to tetramethylrhodamine-6-maleimide with excitation/emission wavelength at 544/572 nm. Its spectral characteristics are very close to those of tetramethylrhodamine-6-maleimide (+2 nm). It is 40% less expensive compared to tetramethylrhodamine-6-maleimide, and can be used for thiol modification of proteins, antibodies and peptides.

Sale

Catalog Number: (103008-616)

Supplier: Anaspec Inc

Description: This peptide is histone H3 amino acid residues 1 to 21. It is asymmetrically dimethylated at arginine 8 with both methyl groups added to one nitrogen of the guanidinium group, and contains a C-terminal biotinylated lysine.
Sequence:ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2
MW:2636.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102996-268)

Supplier: Anaspec Inc

Description: The native peptide, PLARTLSVAGLPGKK (cat# 22511), is a selective substrate for CaM kinase II and protein kinase C. It is a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. The relative Vmax/Km ratios of the peptide for different kinases are 100 for CaMK II, 22 for protein kinase C, 2 for phosphorylase kinase, and 0.5 for myosin light chain kinase respectively.
Sequence:PLARTLSVAGLPGKK
MW:1507.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale