You Searched For: Hytest Ltd

Catalog Number: (103008-184)

Supplier: Anaspec Inc

Description: The short peptide RGDS (Arg-Gly-Asp-Ser) is a synthetic cell adhesion factor. RGDS is known to mediate cell adhesion to several extracellular matrix components as well as cell–cell interactions. The RGDS peptide has been shown to interact directly with and activates caspases 8 and 9, which indicates an unexpected pro-apoptotic effect due to an intracellular action.
Sequence:RGDS
MW:433.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Molecular Weight: 4329.9+36.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-118)

Supplier: Anaspec Inc

Description: This is the N-terminal fragment of b-Amyloid peptide amino acids 1 to 9. Omission of residues 1 to 9 from the full-length Alzheimer's b-Amyloid peptide 1 to 40 does not prevent the peptide from forming amyloid fibrils or eliminate fibril polymorphism. This b-Amyloid peptide fragment contains a functional B cell epitope, but lacks known T cell epitopes, which makes it an attractive candidate for the development of b-Amyloid vaccine that lacks the potential to induce autoimmune encephalitis.
Sequence: DAEFRHDSG
Molecular Weight: 1033 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103002-990)

Supplier: Anaspec Inc

Description: ERKtide is a peptide substrate for ERK2. Extracellular regulated protein kinase 2 (ERK2) is a eukaryotic protein kinase whose activity is regulated by mitogenic stimuli.
Sequence:ATGPLSPGPFGRR
MW:1312.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103003-160)

Supplier: Anaspec Inc

Description: A specific rat renin inhibitor.
Sequence:Ac - HPFV - (Sta) - LF - NH2
MW:957.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-130)

Supplier: Anaspec Inc

Description: Hydrogen peroxide is involved in a number of biological events, in particular, free radical-induced biochemical reactions.

Sale

Catalog Number: (103010-470)

Supplier: Anaspec Inc

Description: β-galactosidase, encoded by the lacZ gene in E

Sale

Catalog Number: (103003-754)

Supplier: Anaspec Inc

Description: This is a tyrosine phosphorylated angiotensin II peptide with a substrate sequence specificity for chymase to act. This is an octapeptide hormone that is formed as a result of the action of human heart chymase, a chymotrypsin-like serine protease on the Phe-His bond of Angiotensin I. The ideal susbtrate for human heart chymase should contain this peptide sequence, and has been demonstrated that the Pro-Phe sequence in P2-P1 positions of peptide substrates is highly favored by leukocyte chymotrypsin-like proteinases such as chymases and cathepsin G.
Sequence: DRV-pY-IHPF
MW: 1126.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103010-480)

Supplier: Anaspec Inc

Description: Thiols, compounds that contain sulfhydryl group, are powerful reducing agents capable of acting as antioxidants, enzyme cofactors, and neuromodulators.

Sale

Catalog Number: (103010-634)

Supplier: Anaspec Inc

Description: The SensoLyte® ThT β-Amyloid (1-40) Aggregation kit provides a convenient and standard method to measure Aβ40 aggregation using Thioflavin T dye

Sale

Catalog Number: (103007-070)

Supplier: Anaspec Inc

Description: Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases.
This peptide is a cathepsin S substrate fluorescently labeled with AMC (Ex/Em=354 nm/442 nm). It can be used to measure cathepsin S activity.
Sequence:Ac-KQKLR-AMC
MW:871.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-512)

Supplier: Anaspec Inc

Description: This is amino acid residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
Sequence: HCLGKWLGHPDKF
MW: 1537.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103006-002)

Supplier: Anaspec Inc

Description: An ACE-2 (Angiotensin I-converting enzyme 2) fluorescent substrate. Complete hydrolysis of 0.04 mM results in a 300-fold fluorescence increase over background. Max Abs/Em=325/393 nm upon cleavage of substrate.
Sequence: Mca-APK(Dnp)
MW: 696.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103010-936)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 555 amine is a carbonyl-reactive fluorescent labeling dye that generates the conjugates that are only slightly red-shifted compared to those of Cy3 dye, resulting in an optimal match to filters designed for Cy3 dyes.

Sale

Catalog Number: (103008-444)

Supplier: Anaspec Inc

Description: This peptide sequence is derived from the Gag spacer peptide p1 that is encoded in the frameshift region of human immunodeficiency virus type 1 (HIV-1).
Sequence:HHHHHHIIKIIK
MW:1549.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale