You Searched For: Hytest Ltd

Catalog Number: (102996-764)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a generic fluorogenic substrate for assaying MMPs. Abs/Em = 325/393 nm.
Sequence:Mca-PLGL-Dap(Dnp)-AR
MW:1094.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-106)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 21. It is phosphorylated at Ser10 with a C-terminal GG linker followed by a biotinylated lysine. The phosphorylation of Histone H3 at Ser10 is a mitotic marker and is associated with chromosome condensation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARK-pS-TGGKAPRKQLA-GGK(Biotin)-NH2
MW:2802.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102999-386)

Supplier: Anaspec Inc

Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
MW: 4670.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103006-892)

Supplier: Anaspec Inc

Description: 26Rfa is a neuropeptide belonging to the RFamide peptide family. It exhibits orexigenic activity and has been associated to obesity. The primary structures of human, rat, and frog 26RFa exhibit 80% identity, and the C-terminal octapeptide is fully conserved from amphibians to mammals.
Sequence:TSGPLGNLAEELNGYSRKKGGFSFRF-NH2
MW:2832.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-148)

Supplier: Anaspec Inc

Description: This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.
Sequence: YGRKKRRQRRRAKEGANVAG
MW: 2357.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (102996-408)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103003-178)

Supplier: Anaspec Inc

Description: This is a fluorescent (HiLyte™ Fluor 488)-labeled ß-Amyloid peptide, Abs/Em = 503/528 nm.

Sale

Catalog Number: (103008-728)

Supplier: Anaspec Inc

Description: This linear peptide is derived from the C-terminus of the chemokine, complement fragment 5 anaphylatoxin (C5a). This peptide functions to inhibit C5a binding and function at human and rat C5a receptors. C5a is crucial to triggering cellular immune responses and its overexpression is involved in arthritis, Alzheimer’s disease, cystic fibrosis, systemic lupus erythematosus, and other immunoinflammatory diseases
Sequence:FKP-(D-Cha)-Wr
MW:886.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-710)

Supplier: Anaspec Inc

Description: This peptide is a poly-gamma-D-glutamic acid (DPGA)10 construct that relates to the sequence of the Bacillus anthracis capsule which is composed of gamma DPGA. gamma DPGA is an essential virulence factor of B. anthracis. The capsule inhibits innate host defense through its antiphagocytic action. gamma DPGA is a poor immunogen, but when bound to a carrier protein, it elicits serum antibodies.

Sale

Catalog Number: (103008-434)

Supplier: Anaspec Inc

Description: This is a 5-FAM-labeled Smac/Diablo Peptide (Abs/Em=492/518 nm), which serves as a Livin inhibitor. Livin prevents apoptosis and sensitizes Livin-expressing cells to chemotherapy. This peptide has the potential to be used as a therapeutic agent in cancer treatment.
Sequence:AVPIAQKSEK-K(5-FAM)-NH2
MW:1555.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: RKRSRAE is a selective substrate for protein kinase G (PKG) with a strong preference for PKG Iα (Km = 59 µM) over PKG II (Km = 305 µM).
Sequence:RKRSRAE
MW:902 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-418)

Supplier: Anaspec Inc

Description: This is a fluorescent (FAM)-labeled TAT peptide, Abs/Em = 494/521 nm.
Sequence: FAM-YGRKKRRQRRR
MW: 1918.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103010-170)

Supplier: Anaspec Inc

Description: Central to the execution phase of apoptosis are the two closely related caspase-3 and caspase-7

Sale

Catalog Number: (103005-892)

Supplier: Anaspec Inc

Description: This is a negative control peptide containing the reversed sequence of the first two amino acids of the receptor-activating (tethered ligand) peptide SFLLRN-NH2. It shows no detectable affinity for the binding sites.
Sequence:FSLLRN-NH2
MW:747.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: The sequence (Accession # NP_003076)) corresponds to the human β-synuclein along with a 6x His tag expressed in E. coli. This human β-synuclein recombinant protein is offered at a low endotoxin level of <0.1 EU per μg protein.
Beta-synuclein belongs to the family of highly conservative proteins in vertebrates. N-terminal of β-synuclein is highly homologous to α-, γ-synucleins and consists of degenerative “KTKEGV” repeats. Similar to α-synuclein, beta-synuclein is found primarily in the brain; however, it does not associate with Lewy bodies in Parkinson disease like α-synuclein. Beta-synuclein was found to inhibit production of phosphatidic acid by the phospholipase D2 transmembrane protein in vitro. In addition, beta-synuclein was detected in many breast and ovarian tumors. Recent investigations demonstrated that beta-synuclein can induce mild experimental autoimmune encephalomyelitis (EAE) in Lewis rats.
The human β-synuclein recombinant proteins from AnaSpec are offered with low endotoxin levels of <1 EU per μg protein.

Catalog Number: (103010-650)

Supplier: Anaspec Inc

Description: The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography followed by GST tag cleavage and removal. The molecular weight of the recombinant DJ-1 protein is 19.9 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Sale