Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103007-244

HIV TAT-NSF700scr Peptide

Catalog Number: (103007-244)
Supplier: Anaspec Inc
Description: This scrambled human immunodeficiency virus (HIV) transactivator of transcription (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide. It does not inhibit the disassembly activity of NSF in contrast to the TAT-NSF700 which plays a critical role in regulating exocytosis.
Sequence: YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
MW: 4109.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103010-762

6-Carboxyfluorescein

Supplier: Anaspec Inc
Description: 6-FAM is another isomer of carboxyfluorescein. It is mainly used in sequencing of nucleic acids and labeling nucleotides.

Image Unavailable-103008-024

[Lys(Me2)9]-Histone H3 (3-17)

Catalog Number: (103008-024)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 10 di-methylated at Lys-9.
Sequence:TKQTAR-K(Me2)-STGGKAPR
MW:1614.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-358

[Arg(Me1)3]-Histone H4 (1-23)-GGK,Biotin

Catalog Number: (103009-358)
Supplier: Anaspec Inc
Description: This peptide is histone H4 (1-23) monomethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Methylation of Arg3 is catalyzed by PRMT1 and functions to promote p300 acetylation of histone H4. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-R(Me1)-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2843.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-326

Tetanus Toxin (830–844)

Catalog Number: (103007-326)
Supplier: Anaspec Inc
Description: This peptide belongs to 830 to 844 amino acid sequence of the tetanus toxin Tc, human, common for most MHC molecules.
Sequence:QYIKANSKFIGITEL
MW:1725 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102999-356

Human [Gla17,21,24]-Osteocalcin (1-49) Peptide

Supplier: Anaspec Inc
Description: Osteocalcin (OC) is a 49 amino acid peptide found exclusively in bone tissue and is highly conserved among species. It is a vitamin K- and D-dependent protein produced by osteoblasts, osteocytes and odontoblasts. It is deposited in extracellular bone matrix and is found in the serum. Serum osteocalcin, hydrolysed in the kidney and liver, is considered a specific marker of osteoblast activity and bone formation rate. It may be involved in regulation of osteoblast function, regulation of bone turnover and/or mineralization.
Sequence: YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
MW: 5929.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-103007-264

Bax BH3 peptide (55-74)

Catalog Number: (103007-264)
Supplier: Anaspec Inc
Description: This is a 20–amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models. In addition to disrupting Bax/Bcl-2 and Bax/Bcl-XL, it can promote cytochrome c release from isolated mitochondria. Bax BH3 belongs to the Bcl-2 protein family which consists of both pro-apoptotic and anti-apoptotic members. Bax BH3 acts to regulate apoptosis via governance of the 'intrinsic' pathway of cell death.
Sequence:STKKLSECLKRIGDELDSNM
MW:2267.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-460

Drosophila Antennapedia Peptide, FITC (Fluorescein Isothiocyanate)

Supplier: Anaspec Inc
Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
This is a fluorescent (FITC)-labeled Antennapedia, Abs/Em = 493/522 nm.
Sequence:FITC-LC-RQIKIWFQNRRMKWKK-NH2
MW:2748.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103006-594

p53 (17-26)

Catalog Number: (103006-594)
Supplier: Anaspec Inc
Description: This peptide is amino acids 17 to 26 fragment of p53, the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that contact the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development.
Sequence:ETFSDLWKLL
MW:1251.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-362

Human Beta-Amyloid (1-17)-Cys

Catalog Number: (103007-362)
Supplier: Anaspec Inc
Description: This peptide amino acids 1 to 17 is a modified fragment of the b-amyloid peptide, with cysteine substituted for valine at position 17.
Sequence: DAEFRHDSGYEVHHQKLC
Molecular Weight: 2171.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103011-030

5-TAMRA cadaverine

Catalog Number: (103011-030)
Supplier: Anaspec Inc
Description: 5-TAMRA cadaverine is the purified single isomer of 5(6)-TAMRA cadaverine mixture. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-isomer and 6-isomer might have biological implications.
Image Unavailable-103009-090

[Lys(Ac)14/18/23/27]-Histone H3 (1-30)-GGK,Biotin

Catalog Number: (103009-090)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (1-30) acetylated at Lys14, Lys18, Lys23 and Lys27, with a C-terminal GG linker followed by a biotinylated Lys. Hyperacetylation of histone H3 plays a role in chromatin structure and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAP-GGK(Biotin)
MW:3802.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102998-700

Multiple Antigenic Peptide

Catalog Number: (102998-700)
Supplier: Anaspec Inc
Description: Multiple Antigenic Peptides (MAPs) are synthetic peptides with 4 branches harboring 2 Lysines each. The Lys residues are used as a scaffold to support 8 peptides. MAPs are used to increase the mass of the peptide entity when used as antigen in immunizations. They represent an alternative to carrier proteins, such as BSA or KLH.
Sequence:K4K2KA - NH2
MW:985.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-488

[pSer28]-Histone H3 (21-44)-GK,Biotin

Catalog Number: (103009-488)
Supplier: Anaspec Inc
Description: This is histone H3 (21-44) phosphorylated at Ser28 with an additional C-terminal glycine followed by a biotinylated lysine. Phosphorylation of Ser28 occurs in prophase of mitosis and is associated with the initiation of chromosome condensation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARK-pS-APATGGVKKPHRYRPG-GK(Biotin)
MW:2997.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-222

QXL® 490 acid fluorescent dye

Catalog Number: (103010-222)
Supplier: Anaspec Inc
Description: QXL® 490 dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores.
Image Unavailable-103006-502

[Asp370]-Tyrosinase (368-376)

Catalog Number: (103006-502)
Supplier: Anaspec Inc
Description: This tumor antigenic peptide presented by HLA-A2 antigen to CTLs, is a tyrosinase fragment. Tyrosinase is a membrane-bound protein involved in the melanin synthesis pathway that is expressed by virtually all primary melanoma lesions and by most of metastatic lesions.
Sequence:YMDGTMSQV
MW:1031.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,057 - 1,072 of 1,910
no targeter for Bottom