You Searched For: Hytest Ltd

Catalog Number: (103008-684)

Supplier: Anaspec Inc

Description: This is an amidated version of Histone H4 residues 8-25. It contains two additional residues (WC) on its C-terminus.
Sequence:KGLGKGGAKRHRKVLRDNWC-NH2
MW:2278.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103009-358)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-23) monomethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Methylation of Arg3 is catalyzed by PRMT1 and functions to promote p300 acetylation of histone H4. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-R(Me1)-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2843.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-326)

Supplier: Anaspec Inc

Description: This peptide belongs to 830 to 844 amino acid sequence of the tetanus toxin Tc, human, common for most MHC molecules.
Sequence:QYIKANSKFIGITEL
MW:1725 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102998-158)

Supplier: Anaspec Inc

Description: Peptides are used as insulin receptor tyrosine kinase substrates.
Sequence:TRDI-pY-ETD-pY-pY-RK
MW:1862.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-596)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 (21-44). It is acetylated at lysine 36 with a C-terminal G linker followed by a biotinylated lysine. The acetylation of histone H3 at lysine (K) 36 is highly conserved in mammals and is mainly localized to the promoters of RNA polymerase II-transcribed genes. The transition between the acetylation and methylation of K36 acts as an “acetyl/methyl switch”, controlling chromatin function along transcription units. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPATGGV-K(Ac)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103011-036)

Supplier: Anaspec Inc

Description: This product is a very useful building block for preparing red fluorescent biomolecules. We have also proven that it is a good transglutaminase substrate.

Sale

Catalog Number: (103010-016)

Supplier: Anaspec Inc

Description: The peptide YFLLRNP is an antagonist to thrombin and SFLLRNP (thrombin receptor agonist peptide) in human platelets. YFLLRNP can induce partial activation of human platelets, visible by shape change; but it is unable to fully activate the platelets.
Sequence: YFLLRNP - OH
MW: 922.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103006-570)

Supplier: Anaspec Inc

Description: This peptide is a second complement component (C2), the physiological substrate for the proenzyme Cls, first complement component. The complement system is a central component of host defense but can also contribute to the inflammation seen in pathological conditions. The C1s protease of the C1 complex initiates the host defense pathway. This peptide employs 2Abz/Dnp FRET pair for quantitation of complement enzyme activity.
Sequence:2Abz-SLGRKIQIK(Dnp)-NH2
MW:1326.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-602)

Supplier: Anaspec Inc

Description: Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the English mutation, with His at position 6 replaced with Arg, was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4348.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103009-844)

Supplier: Anaspec Inc

Description: This peptide is Histone 3 amino acid residues 21 to 44. It is mono-methylated at Lys27 and Lys36 with a C-terminal G linker followed by a biotinylated lysine. Histone methylation plays an important role in the regulation of chromatin structure and function. Related Peptides: [Lys(Ac)27, Lys(Me1)36]-Histone H3 (21-44)-GK(Biotin), H3K27(Ac)K36(Me1), biotin-labeled, Cat# 65444 [Lys(Ac)27, Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K27(Ac)K36(Me2), biotin-labeled, Cat# 65445
Sequence:ATKAAR-K(Me1)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2946.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102996-380)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36) amide, is labeled with biotin at the peptide N-terminus. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37)-Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36)-Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: Biotin-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 3524 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103011-096)

Supplier: Anaspec Inc

Description: Luminescent substrate for firefly luciferase.

Sale

Catalog Number: (103007-348)

Supplier: Anaspec Inc

Description: This peptide is amino acids 25 to 35 fragment of the ß-amyloid biotinylated at C-terminus. This peptide possesses many of the characteristics of the full-length ß-amyloid peptide, including an amphiphilic nature and an ability to aggregate, and can serve as a model system to study the conformational changes involved in Alzheimer's disease. Aggregates of ß-amyloid (25–35) have been shown to possess the neurotrophic and neurotoxic properties of their full-length counterparts and there is evidence that the monomeric form of the peptide may itself be cytotoxic.
Sequence: Biotin-GSNKGAIIGLM
Molecular Weight: 1286.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103010-462)

Supplier: Anaspec Inc

Description: Peroxidases catalyze oxidation-reduction reactions and play an important role in protecting cell from oxidative injury

Sale

Catalog Number: (103007-290)

Supplier: Anaspec Inc

Description: This renin FRET peptide is a specific substrate for rat renin. In the FRET peptide, the fluorescence of 5-FAM is quenched by QXL® 520. Upon cleavage into two separate fragments by rat renin, the fluorescence of 5-FAM is recovered, and can be monitored at excitation/emission = 490/520 nm. The SensoLyte® 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.
MW: 2000 - 2200 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C