Print…

You Searched For: Hytest Ltd


2,094  results were found

Refine Results Sort by

Sort Results

List View Easy View (new)
SearchResultCount:"2094"

Rate These Search Results

Image Unavailable-103007-416

Pyrrhocoricin 1 mg

Description: Pyrrhocoricin, Sequence: VDKGSYLPRPTPPRPIYNRN, Purity: By HPLC greater than or equal to 95%, proline-rich cationic antibacterial peptide pyrrhocoricin kills responsive bacteria, Molecular Weight: 2340.7, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-416
Supplier: Anaspec Inc
Image Unavailable-103003-348

Fibrinogen Binding Inhibitor Peptide 1 mg

Description: Fibrinopeptide B, human, Purity: HPLC >/- 95%, MW: 1553.6, Sequence: Pyr-Gly-Val-Asn-Asp-Asn-Glu-Glu-Gly-Phe-Phe-Ser-Ala-Arg-OH, Appearance: Powder, is an N-terminal modified peptide with pyroglutamylation, Size: 1 mg
Catalog Number: 103003-348
Supplier: Anaspec Inc
Image Unavailable-103007-368

Delta - Toxin (1 - 26) 1 mg

Description: Delta - Toxin (1 - 26), Staphylococcus aureus, Sequence: MAQDIISTIGDLVKWIIDTVNKFTKK, Purity: By HPLC greater than or equal to 95%, 26-residue hemolytic peptide secreted by Staphylococcus aureus, Molecular Weight: 2978.6, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-368
Supplier: Anaspec Inc
Image Unavailable-102998-430

Human ACTH (7-38)

Description: Human ACTH (7-38)
Catalog Number: 102998-430
Supplier: Anaspec Inc
Image Unavailable-102996-560

Peptide YY 1 mg

Description: Peptide YY, human, Purity: HPLC >/= to 95%, Molecular Weight: 4309.8, Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-560
Supplier: Anaspec Inc
Image Unavailable-102997-266

Human Beta-Amyloid (2-40)

Description: Human Beta-Amyloid (2-40)
Catalog Number: 102997-266
Supplier: Anaspec Inc
Image Unavailable-103007-806

MOG (35-55) human 1 mg

Description: MOG (35-55), human, Sequence: MEVGWYRPPFSRVVHLYRNGK, Purity: >/= 95%, This is amino acids 92 to 106 fragment of the myelin oligodendrocyte glycoprotein, can be used to induce experimental autoimmune encephalomyelitis, Molecular Weight: 2592, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-806
Supplier: Anaspec Inc
Image Unavailable-103011-028

5(6)-TAMRA cadaverine 10 mg

Description: 5(6)-TAMRA cadaverine, Synonym: Tetramethylrhodamine 5-(and-6)-carboxamide cadaverine, reagent for modifying carboxy groups via EDC-mediated reactions, Molecular Weight: 514.62, Spectral Properties: Abs/Em = 544/570 nm, Solvent System DMF or DMSO, Size: 10 mg
Catalog Number: 103011-028
Supplier: Anaspec Inc
Image Unavailable-103006-690

Caloxin 1b1 1 mg

Description: Caloxin 1b1, for binding to extracellular domain 1 of PMCA4, to examine its effects on smooth muscle and endothelium, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): TAWSEVLHLLSRGGG, Molecular Weight: 1582.8, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-690
Supplier: Anaspec Inc
Image Unavailable-103010-628

SensoLyte* Rh110 Enterokinase Activity Assay Kit

Description: SensoLyte* Rh110 Enterokinase Activity Assay Kit *Fluorimetric*, Components: Rh110 Enterokinase substrate 2 mM, 50 uL, Rh110 2 mM, 10 uL, Recombinant bovine enterokinase 40 uL, 2X Assay Buffer 25 mL, Enterokinase Inhibitor 50 mM, 20 uL
Catalog Number: 103010-628
Supplier: Anaspec Inc
Image Unavailable-103008-684

Histone H4 (8-25)-WC 1mg

Description: Histone H4 (8-25)-WC, amide, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2278.7, Sequence: KGLGKGGAKRHRKVLRDNWC-NH2, amidated version of Histone H4 residues 8-25. It contains two additional residues (WC) on its C-terminus, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-684
Supplier: Anaspec Inc
Image Unavailable-102997-152

CEF8, Influenza Virus NP (383 - 391) 1 mg

Description: CEF8, Influenza Virus NP (383 - 391), SRYWAIRTR, HLA-B*3501 restricted influenza virus nucleoprotein epitope, Sequence (Three-Letter Code) H - Ser - Arg - Tyr - Trp - Ala - Ile - Arg - Thr - Arg - OH, MW: 1208.4, Physical State: Solid, at-20deg C, Size: 1mg
Catalog Number: 102997-152
Supplier: Anaspec Inc
Image Unavailable-103003-406

Glucagon (1-37) Oxyntomodulin 1 mg

Description: Glucagon (1-37), Oxyntomodulin, porcine, Purity: HPLC >/- 95%, Molecular Weight: 4421.9, Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, Following nutrient ingestion, both GLP-1, and OXM are processed from proglucagon and secreted, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-406
Supplier: Anaspec Inc
Image Unavailable-103003-270

Prototype of RGD-containing peptide 1 mg

Description: Prototype of RGD-containing peptide, Purity: HPLC >/- 95%, Molecular Weight: 1091.6, Sequence: FITC-LC-Gly-Arg-Gly-Asp-Ser-Pro-OH, label: FITC, Appearance: Lyophilized red powder, This is a fluorescent labeled Prototype of RGD-containing peptide, Size: 1 mg
Catalog Number: 103003-270
Supplier: Anaspec Inc
Image Unavailable-103007-156

2837b, Hemoglobin Fragment, Plasmepsin II (PM II) substrate, EDANS/ DABCYL 1 mg

Description: 2837b, Hemoglobin Fragment, Plasmepsin II (PM II) substrate, EDANS/ DABCYL, Sequence: EDANS-CO-CH2-CH2-CO-ALERMFLSFP-Dap(DABCYL)OH, Purity: By HPLC >/= 95%, Molecular Weight: 1896, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-156
Supplier: Anaspec Inc
Image Unavailable-102996-564

Peptide YY (3-36) 1 mg

Description: Peptide YY (3-36), human, Purity: HPLC >/= to 95%, Molecular Weight: 4049.5, Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a Y2R agonist, is released from the gastrointestinal tract postprandially, Size: 1 mg
Catalog Number: 102996-564
Supplier: Anaspec Inc
1 - 16 of 2,094