You Searched For: Hytest Ltd

Description: BNP-32, human, Purity: HPLC >/= to 95%, Molecular Weight: 3464.1, Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH, Appearance: Lyophilized white powder, It is also called the brain natriuretic peptide because it was first identified in porcine brain, Storage: -20 deg C, Size: 1 mg

Catalog Number: 102996-424

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Anti - MOG(35 - 55) IgG Quantitative ELISA Kit (mouse/rat), Contains: Pre-coated and pre-blocked 96-well strip plate, Standard for calibration, A detailed protocol, Storage: 4degree C, Size: 96 assays

Catalog Number: 102997-814

Supplier: Anaspec Inc

Sale

Description: HNP-1, Defensin Human Neutrophil Peptide-1, Purity: HPLC >/- 95%, Molecular Weight: 3442.1, Sequence: ACYCRIPACIAGERRYGTCIYQGRLWAFCC, Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine, Size: 0.1 mg

Catalog Number: 103003-370

Supplier: Anaspec Inc

Sale

Description: SensoLyte* Rh110 Matriptase Activity Assay Kit, Fluorimetric, Contains: Rh110 Matriptase substrate, Rh110 fluorescence reference standard, Matriptase, human recombinant, Assay Buffer, Leupeptin, Storage: -20 degree C, Size: 100 Assays (96-well plate)

Catalog Number: 103008-976

Supplier: Anaspec Inc

Sale

Description: Fura-2, AM, Excitation-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration, Molecular Weight: 1001.9, Spectral Properties: Abs/Em = 363/512 nm, Solvent System: DMSO, CAS No: 108964-32-5, Molecular formula: C44H47N3O24, Storage -20 deg C, Size: 1 mg

Catalog Number: 103011-172

Supplier: Anaspec Inc

Sale

Description: TAT (47 - 57), Purity: % Peak Area By HPLC >/= 95%, Molecular Weight: 1559.9, Sequence: (One-Letter Code): YGRKKRRQRRR the most characterized fragment of the HIV transactivator protein (TAT), Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103005-826

Supplier: Anaspec Inc

Sale

Description: PACAP (6-38), amide, human, ovine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 4024.8, Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP, Storage: -20 deg C, Size: 0.5 mg

Catalog Number: 102996-258

Supplier: Anaspec Inc

Sale

Description: Melan-A/MART-1 (27-35), Purity: HPLC >/- 95%, Molecular Weight: 814.6, Sequence: H-Ala-Ala-Gly-Ile-Gly-Ile-Leu-Thr-Val-OH, Appearance: Powder, Melan-A is a melanocyte differentiation antigen recognized by cytotoxic T lymphocytes, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103003-258

Supplier: Anaspec Inc

Sale

Description: Biotin-X NTA [[Biotin-X nitrilotriacetic acid, tripotassium salt]], Molecular Weight: 716, Appearance: solid, Solvent System: water, Excellent reagent for detecting polyhistidine-containing biomolecules, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103003-304

Supplier: Anaspec Inc

Sale

Description: QXL* 490 acid, Molecular Weight: 377.42, Solvent System DMSO or DMF, dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of EDANS and AMCA, Storage -20 deg C, size: 5 mg

Catalog Number: 103010-224

Supplier: Anaspec Inc

Sale

Description: Renin Substrate, human, Purity: HPLC >/= 95%, Molecular Weight: 1760, Sequence: H-Asp-Arg-Val-Tyr-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Asn-OH, Appearance: Powder, it acts on this sequence serving as its substrate yielding Angiotensin I and VIHN, Storage: -20 deg C, Size: 1mg

Catalog Number: 102996-064

Supplier: Anaspec Inc

Sale

Description: Big Endothelin-1 (1-38), human, Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11), Purity: By HPLC >/= 95%, Big Endothelin-1 (1-38) is precursor of endothelin 1, Molecular Weight: 4283, Storage: -20 C, Size: 0.5 mg

Catalog Number: 103007-562

Supplier: Anaspec Inc

Sale

Description: MOG (35-55), human, Sequence: MEVGWYRPPFSRVVHLYRNGK, Purity: >/= 95%, This is amino acids 92 to 106 fragment of the myelin oligodendrocyte glycoprotein, can be used to induce experimental autoimmune encephalomyelitis, Molecular Weight: 2592, Storage: -20 C, Size: 1 mg

Catalog Number: 103007-806

Supplier: Anaspec Inc

Sale

Description: OVA (257-264) [SIINFEKL], Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 963.2, Sequence: (One-Letter Code) SIINFEKL, class I (Kb)-restricted peptide epitope of OVA, an octameric peptide, Appearance: white powder, Storage: At -20 degree C, Size: 5mg

Catalog Number: 103002-988

Supplier: Anaspec Inc

Sale

Description: Glu - Glu epitope Tag, Sequence: EYMPME, Purity: HPLC greater than or equal to 95%, 314 to 319 amino acids fragment of the middle T antigen of mouse polymavirus, Molecular Weight: 798.9, Apperance: Powder, Storage: -20 deg C, Size: 5 mg

Catalog Number: 103007-232

Supplier: Anaspec Inc

Sale

Description: GAD65 (206-220), used to test whether IL-10 interferes with expression of CTLA-4, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): TYEIAPVFVLLEYVT, Molecular weight: 1757.1, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-800

Supplier: Anaspec Inc

Sale