You Searched For: Hytest Ltd

Catalog Number: (103003-194)

Supplier: Anaspec Inc

Description: The native peptide, PLSRTLSVSS-NH2 (cat# 60514-1), is a synthetic substrate for Ca2+-calmodulin-dependent protein kinase II (Km = 7.5 µM). Maximal activation of the decapeptide substrate phosphorylation requires the presence of Ca2+ and calmodulin and is dependent on Ca2+ concentration.
Sequence:5-FAM-PLSRTLSVSS-NH2
MW:1403.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-272)

Supplier: Anaspec Inc

Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:C(Npys)-RQIKIWFQNRRMKWKK-NH2
MW:2505 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-936)

Supplier: Anaspec Inc

Description: Group I of this 180 distinct peptide mixtures, in combination with Group II of 18 distinct peptide mixtures (cat# 62335), obtained via positional scanning synthetic peptide combinatorial library (PS-SPCL) can provide sequence preference information of the different kinases. Amount provided is 1 mg of peptide mixture x 180 vials. Sequences: Y-A-Z-X-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-Z-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-Z-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-Z-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-Z-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-Z-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-Z-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-Z-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-X-Z-A-G-K-K(LC-Biotin)-NH2 X = degenerate mixture of the 17 natural amino acids excluding cysteine, serine, and threonine. LC = 'long chain' version with an additional aminohexanoic acid spacer between the biotin and lysine side chain. S/T = equimolar mixture of serine and threonine. Z = fixed position varied between the 20 natural amino acids.

Sale

Catalog Number: (103006-524)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 488 hydroxylamine is a carbonyl-reactive labeling dye, which reacts more readily with aldehydes at physiological pH than other primary amine-containing reagents (such as hydrazides and amines).

Sale

Supplier: Anaspec Inc

Description: Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103011-030)

Supplier: Anaspec Inc

Description: 5-TAMRA cadaverine is the purified single isomer of 5(6)-TAMRA cadaverine mixture. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-isomer and 6-isomer might have biological implications.

Sale

Catalog Number: (103009-090)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (1-30) acetylated at Lys14, Lys18, Lys23 and Lys27, with a C-terminal GG linker followed by a biotinylated Lys. Hyperacetylation of histone H3 plays a role in chromatin structure and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAP-GGK(Biotin)
MW:3802.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-326)

Supplier: Anaspec Inc

Description: This peptide belongs to 830 to 844 amino acid sequence of the tetanus toxin Tc, human, common for most MHC molecules.
Sequence:QYIKANSKFIGITEL
MW:1725 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-740)

Supplier: Anaspec Inc

Description: Reference standard for measuring fluorescence quantum yield.

Sale

Supplier: Anaspec Inc

Description: This is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb.
Sequence: SIINFEKL
MW: 963.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (102999-752)

Supplier: Anaspec Inc

Description: ß-Secretase (BACE1) is a key enzyme involved in the production of Aß peptides found in extracellular amyloid plaques of Alzheimer’s disease (AD). The enzyme has been implicated as an excellent target for anti-amyloid therapy of AD. This statine-based substrate analog, beta-secretase inhibitor P10–P4’ statV, is used in the inhibition of beta-secretase activity from homogenized wild-type mouse cortices and from BACE-purified from human brain.
Sequence:KTEEISEVN-Sta-VAEF (Sta = statine)
MW:1651.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102998-700)

Supplier: Anaspec Inc

Description: Multiple Antigenic Peptides (MAPs) are synthetic peptides with 4 branches harboring 2 Lysines each. The Lys residues are used as a scaffold to support 8 peptides. MAPs are used to increase the mass of the peptide entity when used as antigen in immunizations. They represent an alternative to carrier proteins, such as BSA or KLH.
Sequence:K4K2KA - NH2
MW:985.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102998-444)

Supplier: Anaspec Inc

Description: This peptide is an inhibitor for Angiotensin I Converting Enzyme (ACE I), derived from Bradykinin. ACE I partially suppresses the renin-angiotensin-aldosterone system (RAAS), which regulates blood pressure and may mediate hypertension. ACE I converts angiotensin I to the biologically active peptide angiotensin II using a zinc- and chloride- dependent mechanism.
Sequence: RPPGFSPFR
MW: 1060.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103010-222)

Supplier: Anaspec Inc

Description: QXL® 490 dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores.

Sale

Catalog Number: (103009-012)

Supplier: Anaspec Inc

Description: This peptide represents amino acid residues 5-23 of histone H3 and can be used as a substrate for histone acetyl-transferase (HAT) assays.
Sequence:QTARKSTGGKAPRKQLASK
MW:2013.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-264)

Supplier: Anaspec Inc

Description: This is a 20–amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models. In addition to disrupting Bax/Bcl-2 and Bax/Bcl-XL, it can promote cytochrome c release from isolated mitochondria. Bax BH3 belongs to the Bcl-2 protein family which consists of both pro-apoptotic and anti-apoptotic members. Bax BH3 acts to regulate apoptosis via governance of the 'intrinsic' pathway of cell death.
Sequence:STKKLSECLKRIGDELDSNM
MW:2267.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale