You Searched For: Hytest Ltd

Catalog Number: (103007-842)

Supplier: Anaspec Inc

Description: This peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Ret, Src, TIE2, TrkB, VEGF-R1 (Flt-1) and VEGF-R2 (KDR) is biotinylated on the N-terminus.
Sequence:Biotin-GEEPLYWSFPAKKK-NH2
MW:1905.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This peptide is a HCV protease substrate incorporating an ester bond between residues P1 and P1. Due to ready transesterification of the scissile bond to the acyl-enzyme intermediate, this substrate shows very high kcat/Km values, enabling detection of activity with subnanomolar nonstructural protein 3 (NS3 protease) concentrations. It is widely used for the continuous assay of NS3 protease activity. Substrate cleavage is proportional to the enzyme concentration with a detection limit for NS3 between 1 nM and 250 pM. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 355/500 nm.

Supplier: Anaspec Inc

Description: This 14-residue peptide toxin from the wasp venom is originally found as a histamine releaser from mast cells. It induces mitochondrial membrane permeabilization via a CsA-inhibitable mechanism.
Sequence:INLKALAALAKKIL-NH2
MW:1478.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-474)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (1-35).
Sequence:ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
MW:3551.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103003-222)

Supplier: Anaspec Inc

Description: Peptide sequence KVEKIGEGTYGVVYK is derived from the amino acid residues CDC26-20. It is considered to be a generic substrate for various TPKs.
Sequence:KVEKIGEGTYGVVYK
MW:1669.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103009-700)

Supplier: Anaspec Inc

Description: H3K69 methylation is generally associated with transcriptional activation, with methylation catalyzed by DOT/DOT1L enzyme in the context of a nucleosome. Aberrant methylation of H3K79 has been implicated in leukemias. Histone H3 (69-89) peptides are used for assessing the specificity of anti-H3K79me antibodies.
Sequence:RLVREIAQDFKTDLRFQSSAV-NH2
MW:2479 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-400)

Supplier: Anaspec Inc

Description: A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 6 units of gammaGlu-Cys.
Sequence:(γE-C)6-G
MW:1468.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This is a synthetic peptide substrate for S6 kinase shown to be phosphorylated by protein kinase c with phosphorylation site identified at Ser235.
Sequence:AKRRRLSSLRA
MW:1313.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103011-054)

Supplier: Anaspec Inc

Description: The absorption spectrum of DABCYL Plus™ is environment-sensitive as in the case of DABCYL dyes. For example, in water, the spectrum of DABCYL Plus™ is red-shifted ca. 40 nm compared to that in methanol.

Sale

Catalog Number: (103006-372)

Supplier: Anaspec Inc

Description: Prion protein (PrP), also known as CD230, is mainly produced in the nervous sytem. PrP exists as different isoforms, among which the normal PrPc, and the 'scrapie' isoform PrPSc. PrPSc is misfolded and associated to multiple disorders including bovine spongiform encephalopathy, Gerstmann-Straüssler-Scheindker disease (GSS) and the Creutzfeldt-Jakob disease. It contains a much higher beta-sheet content than PrPc, and tends to form protease-resistant aggregates. A hypothesis to support the propoagation of these aggregates and their role in neurodegeneration is that the change from normal PrPc is due to its interaction with PrPSc 'conformation conversion hypothesis).
PrP 127-147 forms filamentous structures ressembling scrapie-associated fibrils, but possesses a lower amyloidogenic potential than PrP 106-126.
Sequence:KTNMKHMAGAAAAGAVVGGLG
MW:1912.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This is amino acids 1 to 40 fragment of human beta-amyloid differing from those in rat, mouse by three amino acid residues in Arg5, Tyr10, and His13. This peptide is biotinylated at the C-terminus.

Catalog Number: (103009-918)

Supplier: Anaspec Inc

Description: This peptide is Histone 3, with amino acid residues 21 to 44. It is dimethylated at Lys27 and monomethylated Lys36, with a C-terminal G linker followed by a biotinylated lysine. Histone methylation plays an important role in the regulation of chromatin structure and function. 
Sequence:ATKAAR-K(Me2)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103008-446)

Supplier: Anaspec Inc

Description: This sequence is OVA (ovalbumin) peptide residues 257 to 280, also known as OT-II (OVA-specific T-cell receptor) peptide, the core H2b-restricted class II MHC epitope.
Sequence: AAHAEINEA
MW: 925 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103008-518)

Supplier: Anaspec Inc

Description: This peptide is derived from amino acid residues 372-389 of human p53 tumor suppressor protein and is acetylated at Lys382. It is biotinylated at its N-terminus through a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2473 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-812)

Supplier: Anaspec Inc

Description: This insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7. A number of autoimmune diseases has been linked to class II proteins encoded by the MHC. Type 1 diabetes, or insulin-dependent diabetes mellitus, is a T cell-mediated disease that results in autoimmune destruction of pancreatic beta-cells leading to hyperglycemia. This insulin B peptide may be a self-antigen candidate that could initiate the disease. Immunization with this peptide in mice led to autoantibodies and insulitis.
Sequence: SHLVEALYLVCGERG
MW: 1645.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale