Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103010-636

SensoLyte® Thioflavin T β-Amyloid (1-42) Aggregation Kit, AnaSpec

Catalog Number: (103010-636)
Supplier: Anaspec Inc
Description: The SensoLyte® ThT β-Amyloid (1-42) Aggregation kit provides a convenient and standard method to measure Aβ42 aggregation using Thioflavin T dye
Image Unavailable-102996-356

Bovine Neurotensin

Supplier: Anaspec Inc
Description: This 13 amino acid peptide was first isolated from bovine hypothalamus and was named from its neuronal localization. It was detected in the central nervous system (CNS) and peripheral tissues mainly in the gastrointestinal tract. This bioactive form of neurotensin post-translationally modified at a Glu residue was isolated from porcine intestine.
Sequence:Pyr-LYENKPRRPYIL
MW:1673 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-103001-688

Human Recombinant MMP-9 (from E. coli)

Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-9 (92-kDa gelatinase, collagenase-IV) is involved in a number of diseases such as cancer, angiogenesis, alopecia, and metastasis. MMP-9 is secreted as zymogen with prodomain, gelatin-binding domain consisting of three contiguous fibronectin type II units, catalytic domain, proline-rich linker region, and C-terminal hemopexin-like domain. It can degrade a variety of substrates, including gelatin, collagens type IV, V, XIV, a2-macroglobulin, elastin, vitronectin, and proteoglycans.

Image Unavailable-103007-796

Mouse Laminin alpha1 (2110-2127)

Catalog Number: (103007-796)
Supplier: Anaspec Inc
Description: This peptide is derived from mouse laminin alpha1 amino acid residues 2110-2127. Cell matrix substrate constituted with this peptide can promote neurite outgrowth.
Sequence:CSRARKQAASIKVAVSADR-NH2
MW:2016.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-754

5-Carboxyfluorescein

Supplier: Anaspec Inc
Description: 5-FAM is a single isomer. It is one of the most popular green fluorescent reagents used for in situ labeling peptides, proteins and nucleotides. It has also been used to prepare various small fluorescent molecules.

Image Unavailable-103000-578

HIV TAT (47-57) FITC LC Peptide, FITC (Fluorescein Isothiocyanate)

Supplier: Anaspec Inc
Description: This fluorescent (FITC)-labeled TAT peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm.
Sequence: FITC-LC-YGRKKRRQRRR-NH2
MW: 2061.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Image Unavailable-103006-340

Human Apelin-36

Catalog Number: (103006-340)
Supplier: Anaspec Inc
Description: This 36-amino-acid apelin peptide, predicted to comprise the mature form, specifically inhibits infection of APJ-expressing cells by a diverse group of primary HIV-1 viruses.
Sequence:LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
MW:4195.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103008-254

Bak BH3 peptide, TAMRA (5-Carboxytetramethylrhodamin)

Catalog Number: (103008-254)
Supplier: Anaspec Inc
Description: This peptide is derived from the BH3 domain of Bak (Flu-BakBH3). It has high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function. This peptide is labeled with 5-TAMRA on the N-terminus, Abs/Em= 541/568
Sequence:5-TAMRA-GQVGRQLAIIGDDINR
MW:2137.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-584

Bactenecin 2A

Catalog Number: (103008-584)
Supplier: Anaspec Inc
Description: This peptide is Bac2A, a linear variant of the loop-shaped cationic antimicrobial peptide Bactenecin found in bovine neutrophils. The Cys disulfide bond-forming residues of Bactenecin is replaced with Ala in Bac2A, and is active against both gram-positive and gram-negative bacteria.
Sequence:RLARIVVIRVAR-NH2
MW:1420.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-848

5-Carboxytetramethylrhodamine succinimidyl ester (5-TAMRA SE)

Supplier: Anaspec Inc
Description: Although the mixed TAMRA isomers are predominantly used for labeling proteins, the single isomers are increasingly preferred for labeling peptides and nucleotides because they give better resolution in HPLC purification that is often required in the conjugation processes. 5-TAMRA is more often used than 6-TAMRA for labeling peptides and proteins. 6-TAMRA is predominately used for labeling nucleotides and sequencing nucleic acids.

Image Unavailable-102996-438

Fluorogenic DPPIV Substrate, AFC (Antibody-fluorophore conjugate)

Catalog Number: (102996-438)
Supplier: Anaspec Inc
Description: This is a fluorescent peptide, Abs/Em=380/500. It is a substrate for dipeptidyl peptidase IV (DPP IV) and Xaa-Pro dipeptidase.
Sequence:AP-AFC
MW:397.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-238

Human beta-CGRP

Catalog Number: (103008-238)
Supplier: Anaspec Inc
Description: This 37-amino acid peptide is the beta form of Calcitonin-gene-related peptide (β-CGRP), involved extensively in regulation of the cardiovascular and nervous systems. β-CGRP contains a disulphide bridge at the N-terminus, a C-terminal phenylalanine amide important for immune recognition, and an a-helix between residues 8 and 18.
Sequence:ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:3793.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103001-342

SensoLyte® Anti-PLP (139-151) IgG Quantitative ELISA Kit (Mouse) (Colorimetric), AnaSpec

Catalog Number: (103001-342)
Supplier: Anaspec Inc
Description: SensoLyte® Anti-PLP (139 - 151) IgG Quantitative ELISA Kit (Mouse) is optimized to detect mouse anti-PLP (139-151) IgG. This kit is useful to researchers who wish to determine the amount of anti-PLP (139-151) antibody present in biological samples, and can help provide information on the role it plays in the development and treatment of EAE, an animal model for MS pathogenesis. Wells are pre-coated with PLP (139-151) peptide and pre-blocked with BSA. The amount of anti-PLP (139-151) IgG in mouse serum or cerebrospinal fluid is quantified using ELISA (Abs=450 nm). Ample materials and reagents are provided to perform 96 assays.
Image Unavailable-103008-010

[Lys(Me3)27]-Histone H3 (21-44)-GK,Biotin

Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 21 to 44 tri-methylated at Lys-27 with an addidtional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103009-982

Mouse P0 (180-199)

Catalog Number: (103009-982)
Supplier: Anaspec Inc
Description: This peptide is derived from murine peripheral myelin protein P0 amino acid residues 180-199. It is neuritogenic, inducing experimental autoimmune neuritis (EAN) in murine.
Sequence:SSKRGRQTPVLYAMLDHSRS
MW:2290.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-144

[Lys(Me1)12]-Histone H4(1-21)-GGK,Biotin

Catalog Number: (103008-144)
Supplier: Anaspec Inc
Description: This peptide is histone H4 amino acid residues 1 to 21. It is monomethylated at Lys-12 with a C-terminal GG linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Me1)-GGAKRHRKV-GGK(Biotin)
MW:2616.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
17 - 32 of 1,910
no targeter for Bottom