You Searched For: Hytest Ltd

Catalog Number: (103008-596)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 (21-44). It is acetylated at lysine 36 with a C-terminal G linker followed by a biotinylated lysine. The acetylation of histone H3 at lysine (K) 36 is highly conserved in mammals and is mainly localized to the promoters of RNA polymerase II-transcribed genes. The transition between the acetylation and methylation of K36 acts as an “acetyl/methyl switch”, controlling chromatin function along transcription units. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPATGGV-K(Ac)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 21 to 44 mono-methylated at Lys-36 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2931.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Kemptide is a phosphate acceptor peptide that serves as a synthetic substrate for PKA (Km = 16 µM). The corresponding fluorescent and biotinylated peptides are also proven to be good substrates for PKA.
Sequence:5-FAM-LRRASLG
MW:1130.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-168)

Supplier: Anaspec Inc

Description: The SensoLyte® Red Protease Assay Kit is widely used for continuous detection of generic protease activities. The kit uses a casein derivative that is heavily labeled with a rhodamine derivative, resulting in almost total quenching of the conjugate's fluorescence. Compared to the SensoLyte® Green Protease Assay Kit, this kit contains a red fluorescent casein derivative. Protease-catalyzed hydrolysis relieves this quenching conjugate, yielding brightly red fluorescent dye-labeled peptides (Ex/Em=546/575 nm). The increase in fluorescence intensity is directly proportional to protease activity. The SensoLyte® protease assay kits do not require any separation steps and can be used to continuously measure the kinetics of a variety of exopeptidases and endopeptidases.

Sale

Catalog Number: (103006-916)

Supplier: Anaspec Inc

Description: This peptide spans the C-terminus of histone H3, amino acids 116 to 136.
Sequence:KRVTIMPKDIQLARRIRGERA
MW:2508 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102998-432)

Supplier: Anaspec Inc

Description: This ACTH (18-39) fragment is known as the Corticotropin-like Intermediate Lobe Peptide. It stimulates insulin secretion as well as amylase and protein secretion in a dose-dependent manner similar to those of secretin and carbamylcholine.
Sequence: RPVKVYPNGAEDESAEAFPLEF
MW: 2465.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103010-384)

Supplier: Anaspec Inc

Description: TAMRA is one of the most popular fluorophores used in various bioconjugations. 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.

Sale

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 21 tri-methylated at Lys-4 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin)
MW:2765.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-786)

Supplier: Anaspec Inc

Description: This peptide is a scrambled sequence of NADPH oxidase assembly peptide inhibitor gp91 ds-tat. It is used as a control peptide. It is two amino acid residues shorter at the N-terminus compared with the scrambled gp91 ds-tat.
Sequence: RKKRRQRRRCLRITRQSR-NH2
MW: 2453 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103008-078)

Supplier: Anaspec Inc

Description: Tat-Glur23Y, scrambled is a control peptide. The synthetic peptide (Tat-Glur23Y), containing tyrosine residues, blocks phosphorylation of alpha-amino-3-hydroxy-5-methyl-isoxazole-4-propionic acid (AMPA) receptor endocytosis. However, the scrambled version does not have blockade properties. Previous studies show that Tat-Glur23Y, scrambled increase stress levels in mice, while Tat-Glur23Y reduces stress when administered.
Sequence: YGRKKRRQRRRVYKYGGYNE
MW: 2634 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103003-194)

Supplier: Anaspec Inc

Description: The native peptide, PLSRTLSVSS-NH2 (cat# 60514-1), is a synthetic substrate for Ca2+-calmodulin-dependent protein kinase II (Km = 7.5 µM). Maximal activation of the decapeptide substrate phosphorylation requires the presence of Ca2+ and calmodulin and is dependent on Ca2+ concentration.
Sequence:5-FAM-PLSRTLSVSS-NH2
MW:1403.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-272)

Supplier: Anaspec Inc

Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:C(Npys)-RQIKIWFQNRRMKWKK-NH2
MW:2505 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-936)

Supplier: Anaspec Inc

Description: Group I of this 180 distinct peptide mixtures, in combination with Group II of 18 distinct peptide mixtures (cat# 62335), obtained via positional scanning synthetic peptide combinatorial library (PS-SPCL) can provide sequence preference information of the different kinases. Amount provided is 1 mg of peptide mixture x 180 vials. Sequences: Y-A-Z-X-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-Z-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-Z-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-Z-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-Z-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-Z-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-Z-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-Z-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-X-Z-A-G-K-K(LC-Biotin)-NH2 X = degenerate mixture of the 17 natural amino acids excluding cysteine, serine, and threonine. LC = 'long chain' version with an additional aminohexanoic acid spacer between the biotin and lysine side chain. S/T = equimolar mixture of serine and threonine. Z = fixed position varied between the 20 natural amino acids.

Sale

Catalog Number: (103006-524)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 488 hydroxylamine is a carbonyl-reactive labeling dye, which reacts more readily with aldehydes at physiological pH than other primary amine-containing reagents (such as hydrazides and amines).

Sale

Supplier: Anaspec Inc

Description: Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103011-030)

Supplier: Anaspec Inc

Description: 5-TAMRA cadaverine is the purified single isomer of 5(6)-TAMRA cadaverine mixture. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-isomer and 6-isomer might have biological implications.

Sale