You Searched For: Hytest Ltd

Supplier: Anaspec Inc

Description: This is a Histone 3 lysine 36 dimethylated peptide. This peptide has been shown to recruit histone deacetylase complex with nucleosomes and repress transcription. In addition, owing to its epigenetic repressive mark, it allows demethylation by a Jumonji C-domain family member, JMJD5 that functions as a transcription activator by inhibiting HDAC, and regulates cell cycle proliferation.
Sequence:ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin)
MW:2945.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.

Catalog Number: (103008-062)

Supplier: Anaspec Inc

Description: Q4 Peptide (SIIQFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SIIQFEKL
MW: 977.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103007-122)

Supplier: Anaspec Inc

Description: This is the hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42.
Sequence: EDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 1999.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103007-782)

Supplier: Anaspec Inc

Description: This FAM labeled peptide (Abs/Em=492/518 nm) is composed of gp91phox sequence linked to the human immunodeficiency virus (HIV)-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly.
Sequence: 5-FAM-YGRKKRRQRRRCSTRIRRQL-NH2
MW: 3031.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103010-822)

Supplier: Anaspec Inc

Description: Single isomers of ROX are increasingly preferred for labeling peptides and nucleotides because they give better resolution in HPLC purifications that are often required in bioconjugations. Variable ratios of the 5- and 6-isomers often cause complications in the interpretation of labeling results and assay performances.

Sale

Catalog Number: (103008-450)

Supplier: Anaspec Inc

Description: This is amino acids 73 to 92 fragment of bone morphogenetic protein (BMP) knuckle epitope. It is a member of transforming growth factor beta (TGF-B). This peptide fragment is able to raise alkaline phosphate activity in murine multipotent mesenchymal cell
Sequence:KIPKASSVPTELSAISTLYL
MW:2118.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103009-960)

Supplier: Anaspec Inc

Description: KALA is a cationic amphipathic cell-penetrating peptide (CPP). It assumes an alpha-helix conformation when the pH is 7.5. KALA binds oligonucleotides and disrupts cell membrane; therefore, it can be used as a DNA transfection reagent.
Sequence:WEAKLAKALAKALAKHLAKALAKALKACEA
MW:3131.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: 6-FAM is another isomer of carboxyfluorescein. 6-FAM, SE is mainly used in sequencing of nucleic acids and labeling nucleotides.

Catalog Number: (103009-380)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (69-89) biotinylated through the epsilon side chain of a C-terminal Lys. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDFKTDLRFQSSAV-K(Biotin)
MW:2834.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-094)

Supplier: Anaspec Inc

Description: This kit consists of two calibration mixtures for calibrating mass scale in MALDI-TOF or ESI mass spectrometry. Calibration Mixture 1 ranges from 800 to 1800 daltons, and Calibration Mixture 2 from 1800 to 3800 daltons.
Sequence:
MW:
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-366)

Supplier: Anaspec Inc

Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103010-904)

Supplier: Anaspec Inc

Description: NBD-X, succinimidyl ester ≥95% (by HPLC)

Sale

Catalog Number: (103003-274)

Supplier: Anaspec Inc

Description: TET 830 modified/T-helper epitope from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.
Sequence:AQYIKANSKFIGITEL
MW:1797.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-962)

Supplier: Anaspec Inc

Description: TACE (tumor necrosis factor-alpha converting enzyme), α-secretase, or ADAM17 is a member of the ADAM family of proteases that contain both disintegrin and metalloprotease (catalytic) domains

Sale

Catalog Number: (102996-792)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This substrate is readily hydrolyzed by MMP-8, 9 and collagenase-3 (MMP-13), Abs/Em = 325/393 nm. The hydrolysis is inhibited in a 1:1 stoichiometric fashion by the tissue inhibitors of metalloproteinases, TIMP-1, TIMP-2, and TIMP-3.
Sequence:Mca-P-Cha-G-Nva-HA-Dap(Dnp)-NH2
MW:1100.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale