You Searched For: RNA sodium salt

Description: This peptide is based on amino acids 73 to 83 of histone H3. Lysine 79 of Histone H3 (H3K79) has been identified as a residue for acetylation or methylation.Related Peptides: [Lys(Ac)79]-Histone H3 (73-83), H3K79(Ac), Cat# 65438 [Lys(Me3)79]-Histone H3(73-83), H3K79(Me3), Cat# 65439[Lys(biotin)79]-Histone H3 (73-83), H3K79(biotin), Cat# 65440
Sequence:EIAQDFKTDLR
MW:1336.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-750

Supplier: Anaspec Inc

Sale

Description: This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102996-468

Supplier: Anaspec Inc

Sale

Description: QXL® 670 dyes are optimized quenchers for Cy5 and Cy5-like fluorophores such as HiLyte™ Fluor 647.

Catalog Number: 103011-072

Supplier: Anaspec Inc

Sale

Description: This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
MW:4384.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102996-096

Supplier: Anaspec Inc

Sale

Description: 7-Amino-4-methylcoumarin is used to produce fluorogenic substrates

Catalog Number: 103003-518

Supplier: Anaspec Inc

Sale

Description: This is a dimethylated lysine at position 4 of the 1-21 amino acid histone H3 peptide. This form of histone methylation is characterized as being enriched around transcription start sites (TSS). It has been observed that a subgroup of genes linked to T cell functions showed high levels of H3K4me2 within their gene body. While enrichment for H3K4me2 within the gene body is a characteristic trait of expressed genes in yeast, in contrast, H3K4me2 has been shown to be predominantly enriched around the TSS in mammals.
Sequence:ART-K(Me2)-QTARKSTGGKAPRKQLA
MW:2282.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-648

Supplier: Anaspec Inc

Sale

Description: This peptide is an H2-Db-restricted epitope from the Influenza A/PR/8/34 nucleoprotein.
Sequence:ASNENMETM
MW:1027.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-278

Supplier: Anaspec Inc

Sale

Description: This peptide is a renin substrate (angiotensinogen) labeled with EDANS/ DABCYL FRET pair for renin activity studies. The renin-angiotensin system (RAS), acting through type 1 angiotensin (AT1) receptors, is a master regulator of fluid homeostasis.
Sequence:R-E(EDANS)-IHPFHLVIHT-K(DABCYL)-R
MW:2282.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103006-940

Supplier: Anaspec Inc

Sale

Description: Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 102999-606

Supplier: Anaspec Inc

Sale

Description: The renin–angiotensin system (RAS) plays a central role in the regulation of blood pressure and electrolyte homoeostasis. An overactive renin-angiotensin system leads to hypertension. As a result, renin is an attractive target for the treatment of this disease

Recombinant mouse prorenin is produced in HEK cells and purified by chelated metal affinity chromatography. It contains an 8x-Histidine tag at the C terminus. The apparent Mr of recombinant enzyme on SDS-PAGE is 41.7 kDa. Prorenin, the precursor of renin, is a glycosylated aspartic protease that consists of 2 homologous lobes. Prorenin can be activated with trypsin. Its activity can be measured in a FRET-based enzymatic assay

Catalog Number: 103010-552

Supplier: Anaspec Inc

Sale

Description: A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 2 units of gammaGlu-Cys.
Sequence:(γE-C)2-G
MW:540.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-386

Supplier: Anaspec Inc

Sale

Description: This peptide is derived from the carboxyl terminus of moth MCC (88-103) and pigeon cytochrome c plays a major role in T-cell selection. MCC (88-103) can induce positive selection of TCR transgenic thymocytes
Sequence:ANERADLIAYLKQATK
MW:1805.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103005-896

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H4 (1-23) with deimination at Arg3. It contains a C-terminal GGK linker with biotinylation on the side chain of this Lys. Deimination of Arg3 to Cit is carried out by peptidylarginine deiminase (PADI)-4. Although the function of deimination is not clearly known, it has been shown to inhibit Arg methylation and repress nuclear hormone receptor-dependent gene activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-Cit-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2830.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-350

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-9.
Sequence:TKQTAR-K(Me3)-STGGKAPR
MW:1628.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-026

Supplier: Anaspec Inc

Sale

Description: This kit is optimized to detect anti-mouse MOG (1-125) IgG. Wells are pre-coated with recombinant mouse MOG (1-125) protein and pre-blocked with BSA. The amount of anti-mouse MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Ample materials and reagents are provided to perform 96 assays.

Catalog Number: 102998-092

Supplier: Anaspec Inc

Sale

Description: Bombesin is a 14-aa peptide originally isolated from the fire-bellied toad. It has two mammalian homologs, neuromedin and Gastrin-Releasing Peptide (GRP). It binds with high affinity to the GRP receptor, a member of the G-protein-coupled receptor family. It stimulates gastrin release from G cells, and acts in the brain to stop eating behavior.
Bombesin is also a tumor marker for lung small cell carcinoma, neuroblastoma, pancreatic cancer and gastric cancer.
Sequence:Pyr-QRLGNQWAVGHLM-NH2
MW:1620.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102996-082

Supplier: Anaspec Inc

Sale