Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103010-622

SensoLyte® Rh110 Factor Xa Assay Kit (Fluorimetric), AnaSpec Inc.

Catalog Number: (103010-622)
Supplier: Anaspec Inc
Description: Factor Xa (FXa) is a serine endopeptidase composed of two disulfide-linked subunits
Image Unavailable-102996-520

Human Beta-Amyloid (1-39)

Supplier: Anaspec Inc
Description: A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Molecular Weight: 4230.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-102996-314

Human;Pig;Rat Viasoactive intestinal peptide

Supplier: Anaspec Inc
Description: 28-amino acid neuropeptide VIP (Vasoactive Intestinal Peptide) is a neurotransmitter and a neuromodulator.
Sequence:HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
MW:3325.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-103010-798

HiLyte™ Fluor 647 C2 maleimide fluorescent dye

Catalog Number: (103010-798)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 647 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy5 dyes, resulting in an optimal match to filters designed for Cy5 dyes.
Image Unavailable-103010-166

SensoLyte® 490 MMP-12 Assay Kit (Fluorimetric), AnaSpec Inc.

Catalog Number: (103010-166)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components
Image Unavailable-103010-418

SensoLyte® 390 Cathepsin D Assay Kit Fluorimetric, AnaSpec, Inc.

Catalog Number: (103010-418)
Supplier: Anaspec Inc
Description: Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown
Image Unavailable-103007-328

Human Platelet Factor IV 18

Catalog Number: (103007-328)
Supplier: Anaspec Inc
Description: C18G is a synthetic α-helical peptide derived from human platelet factor IV. This peptide was found to be antibacterial and is active against Salmonella.
Sequence:ALYKKLLKKLLKSAKKLG
MW:2043.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103001-684

Human Recombinant MMP-1 (from E. coli)

Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-1 (collagenase-1) is involved in tumor development and metastasis and rheumatoid arthritis. It is proposed as a therapeutic target for these diseases. MMP-1 digests a broad range of substrates, including α-1 antitrypsin, myelin basic protein, collagen I, II, III, VII, VIII, casein, gelatin, and others

Image Unavailable-102996-094

Human Parathyroid Hormone (1-34)

Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103008-218

Chicken OVA (241-270)

Catalog Number: (103008-218)
Supplier: Anaspec Inc
Description: This peptide is OVA peptide residues 241 to 270. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SMLVLLPDEVSGLEQLESIINFEKLTEWTS
MW: 3421.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103006-274

CEF Control Peptide Pool

Catalog Number: (103006-274)
Supplier: Anaspec Inc
Description: This product contains 0.03 mg (net) of the 32 CEF peptides for a total of 1 mg in one vial. Used in the stimulation of IFNγ release from CD8+ T cells in individuals with defined HLA types, these epitopes are useful in applications such as ELISPOT, intracellular cytokine and CTL assays.
% peak area by HPLC: ≥ 95
Storage condition: -20°C
Image Unavailable-103006-582

Human MUC5AC-13

Catalog Number: (103006-582)
Supplier: Anaspec Inc
Description: This glycopeptide is an N-acetyl galactosamine (GalNAc)-modified MUC5AC mucin peptide containing the single site of threonine 13 labeled with GalNAc (T*). Polypeptide N-acetylgalactosaminyltransferase (ppGaNTase) catalyzes the transfer of GalNAc from the nucleotide sugar UDP-GalNAc to threonine. The MUC5AC gene is mainly expressed in gastric and tracheo-bronchial mucosae, and some tumors.
Sequence:GTTPSPVPTTST-T*-SAP (* = GalNAc-modified residue)
MW:1704.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-740

Frog Sauvagine

Catalog Number: (103003-740)
Supplier: Anaspec Inc
Description: A hypotensive and diuretic peptide. Originally isolated from the skin of the frog, Phyllomedusa sauvagei. It affects diuresis in the cardiovascular system and causes the release of ACTH and endorphins.
Sequence:Pyr-GPPISIDLSLELLRKMIEIEKQEKEKQQAANNRLLLDTI-NH2
MW:4599.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102999-342

Human;Mouse;Rat Beta-Amyloid (17-40)

Supplier: Anaspec Inc
Description: In Alheimer's Disease brains, plaques contain amino-terminal truncated beta-Amyloid peptides including the alpha secretase-generated p3 fragments, beta-Amyloid 17-40 and 17-42. They were shown to induce pro-inflammatory cytokine and chemokine production in vitro and in vivo.

Image Unavailable-103006-396

Cyclo (-RGDyK)

Catalog Number: (103006-396)
Supplier: Anaspec Inc
Description: This cyclic RGD peptide contains a subsituted d-Tyr instead of d-Phe on the fourth position. Substitution with Tyr results in a high affinity and selectivity for the avb3 integrin. Substitution with Tyr also allows for electrophilic radiohalogenation if desired.
Sequence:Cyclo(-RGDyK)
MW:619.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-940

Human LL17-29

Catalog Number: (103009-940)
Supplier: Anaspec Inc
Description: This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.
Sequence:FKRIVQRIKDFLRNLV
MW:2045.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
865 - 880 of 1,910
no targeter for Bottom