Description: Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.
Sequence: VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
MW: 2859.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 103003-694

Supplier: Anaspec Inc

Sale

Description: This 14-mer prosaptide sequence is derived from the active neurotrophic region in the amino-terminal portion of the saposin C domain. Synthetic peptides derived from this region are biologically active and are named “prosaptides.” Prosaposin and prosaptides are active on a variety of neuronal cells, stimulating sulfatide synthesis and increasing sulfatide concentration in Schwann cells and oligodendrocytes. This indicates that prosaposin and prosaptides are trophic factors for myelin formation.
Sequence:TaLIDNNATEEILY
MW:1579.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-028

Supplier: Anaspec Inc

Sale

Description: This peptide is derived from the BH3 domain of Bak (Flu-BakBH3). It has high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function. This peptide is labeled with 5-TAMRA on the N-terminus, Abs/Em= 541/568
Sequence:5-TAMRA-GQVGRQLAIIGDDINR
MW:2137.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-254

Supplier: Anaspec Inc

Sale

Description: AnaSpec offers two types of fluoresceinated collagen (type I). This product is water soluble and is used for quick fluorometric measurement of collagenase activity. In this protease substrate, collagen is heavily labeled with FITC, resulting in almost total quenching of the conjugate's fluorescence. Protease-catalyzed hydrolysis relieves this quenching conjugate, yielding brightly green fluorescent dye-labeled peptides. The increase in fluorescence intensity is directly proportional to protease activity. This fluoresceinated collagen is useful for detecting MMP-1 activity.

Catalog Number: 103011-292

Supplier: Anaspec Inc

Sale

Description: A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
MW: 3431.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102998-454

Supplier: Anaspec Inc

Sale

Description: These 15 Cytomegalovirus (CMV) peptides, at 0.25 mg each (total of 3.75 mg/vial), constitute part of the CEF control peptide pool (cat# 61036-025). Now available separately as EBV Control Peptide Pool, CMV Control Peptide Pool (cat# 62339), Influenza control peptide pool (cat# 62340), these peptides have been used in the stimulation of IFNgamma release from CD8+ T cells in individuals with defined HLA types, these epitopes are useful in applications such as ELISPOT, intracellular cytokine and CTL assays. All peptides are provided as net weight based on peptide content.
Sequence:
MW:
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-300

Supplier: Anaspec Inc

Sale

Description: This peptide is a specific VEGFR2/KDR heptapeptide antagonist, it binds VEGFR2 (KDR/flk), completely inhibiting VEGF binding to KDR and preventing VEGF-induced angiogenesis in-vivo. It specifically inhibits human endothelial cell proliferation in-vitro and totally abolishes VEGF-induced angiogenesis in-vivo.
Sequence:ATWLPPR
MW:840 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-280

Supplier: Anaspec Inc

Sale

Description: This is a murine H-2 Db- and Kb-restricted immunodominant CTL epitope of influenza PR8 virus. The CD8+ T cells recovered by the bronchoalveolar lavage (BAL) from PR8-infected animals responded dominantly to stimulation with NP366–374 and PA224–233
Sequence:SSLENFRAYV
MW:1185.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-884

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H3 amino acid residues 1 to 21 acetylated at Lys-9 and Lys-14 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Ac)-STGG-K(Ac)-APRKQLA-GGK(Biotin)
MW:2807.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-992

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H3 acetylated at lysine 9. Histone lysine aetylation is known to play an important role in chromatin-directed gene transcription. A bromodomain 2 of polybromo (a chromatin remodelling protein) preferentially recognizes acetylated lysine of H3.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQL
MW:2225.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-654

Supplier: Anaspec Inc

Sale

Description: The sequence (Accession # AAC04279.1) corresponding to the full length human Tau-441 (2N4R isoform) protein along with GST tag was expressed in E. coli. The recombinant Tau-441 protein was purified from bacterial lysate using proprietary method. GST tag was cleaved and removed using Glutathione agarose.
Applications: In vitro phosphorylation and acetylation, Western immunoblotting and ELISA standard.
Microtubule associated protein (Tau) is found predominantly in the central neural system and its major function is to promote assembly and to stabilize neuronal microtubules. Six isoforms of Tau were identified in humans that are differentiated by the exclusion or inclusion of exons 2, 3, and 10. Tau-441 is the longest of Tau isoforms, consisting of 441 amino acids with molecular mass of 45.8 kDa. Under physiological conditions Tau can undergo abnormal phosphorylation, truncation, or other modifications that result in the protein detachment from microtubules. These modified Tau molecules can self-associate and form different types of aggregates including neurofibrillary tangles (NFTs) found in brains of patients with neurodegenerative diseases such as Alzheimer’s disease.

Catalog Number: 103001-650

Supplier: Anaspec Inc

Sale

Description: This is biotinylated Bradykinin peptide.
Sequence:Biotin-RPPGFSPFR
MW:1286.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102999-768

Supplier: Anaspec Inc

Sale

Description: This is a fluorescent peptide, Abs/Em=380/500. It is a substrate for dipeptidyl peptidase IV (DPP IV) and Xaa-Pro dipeptidase.
Sequence:AP-AFC
MW:397.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102996-438

Supplier: Anaspec Inc

Sale

Description: This peptide is Bac2A, a linear variant of the loop-shaped cationic antimicrobial peptide Bactenecin found in bovine neutrophils. The Cys disulfide bond-forming residues of Bactenecin is replaced with Ala in Bac2A, and is active against both gram-positive and gram-negative bacteria.
Sequence:RLARIVVIRVAR-NH2
MW:1420.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-584

Supplier: Anaspec Inc

Sale

Description: 5-FAM is a single isomer. It is one of the most popular green fluorescent reagents used for in situ labeling peptides, proteins and nucleotides. It has also been used to prepare various small fluorescent molecules.

Catalog Number: 103010-756

Supplier: Anaspec Inc

Sale

Description: 6-ROX, SE is the other purified single isomer of 5(6)-ROX, SE. It appears that 5-ROX is more often used than 6-ROX for labeling peptides and proteins. 6-ROX is predominately used for labeling nucleotides and sequencing nucleic acids.

Catalog Number: 103010-824

Supplier: Anaspec Inc

Sale