You Searched For: X-ray+fluorescence+spectroscopy


1,910  results were found

SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103006-884)
Supplier: Anaspec Inc
Description: This is a murine H-2 Db- and Kb-restricted immunodominant CTL epitope of influenza PR8 virus. The CD8+ T cells recovered by the bronchoalveolar lavage (BAL) from PR8-infected animals responded dominantly to stimulation with NP366–374 and PA224–233
Sequence:SSLENFRAYV
MW:1185.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-674)
Supplier: Anaspec Inc
Description: This is antimicrobial peptide LL-37 with a 6-carbon linker (LC) conjugated to 5-FAM suitable for cell culture and analysis studies.
Sequence: Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
MW: 4832.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas as a response to hypoglycemia. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplished through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin, Obestatin and Somatostatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
MW: 4181.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103008-176)
Supplier: Anaspec Inc
Description: This 1-21 amino acid histone H3 peptide has a trimethylated lysine at position 9. This form of histone methylation is characterized as being enriched around transcription start sites. It has been observed that certain family members of the JMJ enzyme (Jumonji C domain-containing oxygenases) that play a role in regulating the methylation status of histone H3 lysine residues exhibits selectivity towards this peptide.
Sequence:ARTKQTAR-K(Me3)-STGGKAPRKQLA
MW:2296.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-452)
Supplier: Anaspec Inc
Description: A neuropeptide that plays a role in arousal and fear responses.
Sequence:SFRNGVGSGAKKTSFRRAKQ
MW:2182.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103002-836)
Supplier: Anaspec Inc
Description: This pro-apoptotic peptide, also called (klaklak)2, is a programmed cell-death inducing peptide, non toxic outside cells, but toxic once internalized, as it disrupts mitochondiral membranes. It is linked to a targeting domain (NGR), which drives the peptide to target cells and allows its internalization. It contains the Asn-Gly-Arg (NGR) motif which was shown to allow the delivery of anti-tumor compounds to tumor vessels.
Sequence:CNGRCGGklaklakklaklak-NH2 (Disulfide bridge: 1-5)
MW:2168.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-220)
Supplier: Anaspec Inc
Description: This is amino acids 676 to 700 fragment of steroid receptor co-activator (SRC1). This N-terminal biotinylated peptide is derived from the second LXXLL motif of SRC1. Co-activator proteins interact with nuclear receptors in a ligand-dependent manner and augment transcription. A short amphipathic beta-helical domain that includes this LXXLL motif serves as the interaction interface between the co-activator molecules and the ligand-dependent activation function (AF-2) located in the COOH-terminus of the nuclear receptor ligand-binding domain (LBD). Receptor binding domain of the co-activator SRC-1 is specifically recruited to the farnesoid X receptor (FXR) ligand-binding domain.
Sequence:Biotin-CPSSHSSLTERHKILHRLLQEGSPS
MW:3026.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-796)
Supplier: Anaspec Inc
Description: This peptide is derived from mouse laminin alpha1 amino acid residues 2110-2127. Cell matrix substrate constituted with this peptide can promote neurite outgrowth.
Sequence:CSRARKQAASIKVAVSADR-NH2
MW:2016.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103010-138)
Supplier: Anaspec Inc
Description: Central to the execution phase of apoptosis are the two closely related caspase-3 and caspase-7


Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-9 (92-kDa gelatinase, collagenase-IV) is involved in a number of diseases such as cancer, angiogenesis, alopecia, and metastasis. MMP-9 is secreted as zymogen with prodomain, gelatin-binding domain consisting of three contiguous fibronectin type II units, catalytic domain, proline-rich linker region, and C-terminal hemopexin-like domain. It can degrade a variety of substrates, including gelatin, collagens type IV, V, XIV, a2-macroglobulin, elastin, vitronectin, and proteoglycans.

Catalog Number: (103003-344)
Supplier: Anaspec Inc
Description: This hexapeptide, referred to as STAL-2 or TRAP (Thrombin Receptor Activating Peptide), is a protease-activated receptor (PAR-1) agonist peptide.
Sequence:SFLLRN-NH2
MW:747.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Catalog Number: (103008-040)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 31 to 41 tri-methylated at Lys-36.
Sequence:STGGV-K(Me3)-KPHRY
MW:1271.4 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-428)
Supplier: Anaspec Inc
Description: This 12-mer peptide sequence is a transferrin receptor (TfR) targeting peptide. It binds to TfR and is internalized via endocytosis into TfR-expressing cells. TfR targeting peptide is a potential carrier for transportation of small molecules across the blood-brain barrier.
Sequence:THRPPMWSPVWP
MW:1490.8 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-210)
Supplier: Anaspec Inc
Description: This peptide is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP). This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred. The affected individuals share a missense mutation in APP at position 694. This site corresponds to residue 23 of beta-amyloid peptide resulting in substitution of asparagine for aspartic acid.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103006-422)
Supplier: Anaspec Inc
Description: This peptide corresponds to the protein transduction domain of the TAT protein. In some studies this has been used as a PKCε inhibitor peptide and also conjugated to PKC peptides and other molecules such as antisense oligomers for examining cell penetrating abilities.
Sequence: CYGRKKRRQRRR-NH2
MW: 1662 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103010-206)
Supplier: Anaspec Inc
Description: DiSBAC2(3) [[Bis-(1,3-diethylthiobarbituric acid)trimethine oxonol]], Purity: >99% HPLC/TLC, Molecular Formula: C19H24N4O4S2, MW: 436.5, Appearance: Purple solid, Sensitive membrane potential probe, less temperature-dependent than DiBAC, Storage: -20 deg C, Size: 25 mg


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,153 - 1,168 of 1,910
no targeter for Bottom