You Searched For: Biotest AG

Description: [Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102999-364

Supplier: Anaspec Inc

Sale

Description: This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.
Sequence:rrrrrrrrGAELPPEFAAQLRKIGDKVYC
MW:3555.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-832

Supplier: Anaspec Inc

Sale

Description: This is a myristoylated form of Autocamtide-2-Related Inhibitory Peptide (AIP), a highly potent and specific substrate competitive inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII). AIP is derived from Autocamtide-2, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALRRQEAVDAL
MW:1708.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-588

Supplier: Anaspec Inc

Sale

Description: Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This peptide sequence is found in residues 45 to 54 of Metastin (also referred to as Kisspeptin-10). This peptide increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone) in prepubertal dairy heifers. This peptide is the minimal sequence needed to activate GPR54 signaling, which may function in negatively regulating CXCR4’s role in programming tumor metastasis. Specifically, Kisspeptin-10 inhibits signaling and chemotaxis induced by SDF-1.
Sequence:YNWNSFGLRF-NH2
MW:1302.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-822

Supplier: Anaspec Inc

Sale

Description: This is a monomethylated lysine at position 4 of the 1-21 amino acid histone H3 peptide. This form of histone methylation is characterized as being enriched around transcription start sites. It’s chromatin mark was also closely correlated to cell-type specific expression of putative gene targets of enhancers. It was also noted from a genome wide study that most potential regulatory elements were enriched only by the mono-methylated version of this histone 3.
Sequence:ART-K(Me1)-QTARKSTGGKAPRKQLA
MW:2268.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-186

Supplier: Anaspec Inc

Sale

Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-742

Supplier: Anaspec Inc

Sale

Description: Genetic transformation in Streptococcus pneumoniae, Streptococcus mitis and Streptococcus oralis is regulated by secreted peptide pheromones named the competence-stimulating peptide (CSP). Different strains and species of these bacteria produce CSP with different primary sequence. They are termed pheromones CSP-1 (EMRLSKFFRDFILQRKK), CSP-2 (EMRISRIILDFLFLRKK), CSP-153 (DKRLPYFFKHLFSNRTK), CSP-612 (ESRLSRLLRDFIFQIKQ), CSP-676 (ERRIPDVIRSLLFQKRK), and CSP-12261 (EIRQTHNIFFNFFKRR).
Sequence:EMRISRIILDFLFLRKK
MW:2178.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-792

Supplier: Anaspec Inc

Sale

Description: A highly sensitive FRET substrate for assaying HCV (Hepatitis C Virus) NS3/4A protease activity. It detects < 0.1pmol of HCV NS3/4A protease. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 490/512 nm.
Sequence:Ac-DE-Dap(QXL520)-EE-Abu-ψ;-[COO]AS-C(5-FAMsp)-NH2
MW:1913.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-388

Supplier: Anaspec Inc

Sale

Description: Des-octanoyl (or Des-acyl) Ghrelin, DAG, is the unacylated precursor peptide to Ghrelin. Des-octanoyl Ghrelin is converted to Ghrelin by the enzymic addition of an octanyl group. Studies indicate that the amount of Des-octanoyl Ghrelin in the circulation is approximately 20 fold higher than that of Ghrelin. Des-octanoyl Ghrelin is not an agonist of the Ghrelin growth hormone receptor 1a (GHSR1a).
Sequence: GSSFLSPEHQRVQQRKESKKPPAKLQPR
MW: 3244.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 103006-386

Supplier: Anaspec Inc

Sale

Description: Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases.
This peptide is a cathepsin S substrate fluorescently labeled with AMC (Ex/Em=354 nm/442 nm). It can be used to measure cathepsin S activity.
Sequence:Ac-KQKLR-AMC
MW:871.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-070

Supplier: Anaspec Inc

Sale

Description: An ACE-2 (Angiotensin I-converting enzyme 2) fluorescent substrate. Complete hydrolysis of 0.04 mM results in a 300-fold fluorescence increase over background. Max Abs/Em=325/393 nm upon cleavage of substrate.
Sequence: Mca-APK(Dnp)
MW: 696.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: 103006-002

Supplier: Anaspec Inc

Sale

Description: This synthetic peptide is a biotinylated substrate for Syk kinase.
Sequence:Biotin-KEDPDYEWPSAK-NH2
MW:1689.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-864

Supplier: Anaspec Inc

Sale

Description: This is the N-terminal fragment of b-Amyloid peptide amino acids 1 to 9. Omission of residues 1 to 9 from the full-length Alzheimer's b-Amyloid peptide 1 to 40 does not prevent the peptide from forming amyloid fibrils or eliminate fibril polymorphism. This b-Amyloid peptide fragment contains a functional B cell epitope, but lacks known T cell epitopes, which makes it an attractive candidate for the development of b-Amyloid vaccine that lacks the potential to induce autoimmune encephalitis.
Sequence: DAEFRHDSG
Molecular Weight: 1033 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-118

Supplier: Anaspec Inc

Sale

Description: PAMP (1-20) is a biologically active molecule produced by posttranslational processing of proadrenomedullin. This peptide is found in a variety of tissues and exerts important biological activities through specific cell surface receptors. PAMP (1-20) is involved in many physiological processes, including vasodilation, bronchodilation, hormone secretion, cell migration, apoptosis, and angiogenesis. This peptide has been implicated in the pathophysiology of several diseases such as renal and cardiovascular disorders, stroke, cancer, and diabetes.
Sequence:ARLDVASEFRKKWNKWALSR-NH3
MW:2460.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103009-944

Supplier: Anaspec Inc

Sale

Description: This peptide is a substrate for Jak3. It may be used used in kinase assays. Jak3tide contains the phosphorylation site at Tyr7.
Sequence:GGEEEEYFELVKKKK
MW:1813 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-388

Supplier: Anaspec Inc

Sale

Description: Bactenecin is a 12-amino acid cationic antimicrobial peptide from bovine neutrophils.
Sequence:RLCRIVVIRVCR (Disulfide bridge: 3-11)
MW:1483.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-332

Supplier: Anaspec Inc

Sale