You Searched For: Hytest Ltd

Catalog Number: (103010-348)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 750 acid, SE is the longest-wavelength amine-reactive HiLyte™ Fluor dye currently available. Its fluorescence emission maximum at 778 nm is well separated from commonly used far-red fluorophores such as HiLyte™ Fluor 647, HiLyte™ Fluor 680 or allophycocyanin (APC), facilitating multicolor analysis.

Sale

Catalog Number: (103005-978)

Supplier: Anaspec Inc

Description: The family of at least seven transmembrane G protein coupled receptors includes at least four receptor subtypes (PAR1, PAR2, PAR3, PAR4). PAR4 activating peptides, GYPGKF-NH2 and AYPGKG-NH2, produce concentration dependent contractile effects on the muscle.
Sequence: GYPGKF - NH2
MW: 666.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103008-726)

Supplier: Anaspec Inc

Description: This peptide is derived from the C-terminus of the chemokine, complement fragment 5 anaphylatoxin (C5a). This peptide functions as a C5a receptor agonist. C5a is a plasma protein involved in cellular inflammatory processes by inducing chemotaxis, degranulation of leukocytes, increased vascular permeability, and cytokine production. The cyclohexylalanine at position 5 is crucial to agonist function. Arg at the last position is of the d-isomer.
Sequence:FKP-(D-Cha)-Cha-r
MW:853.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This is scrambled control peptide used in studies to compare the effects of Beta-Amyloid (1-42).
Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA
Molecular Weight: 4514.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103009-380)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (69-89) biotinylated through the epsilon side chain of a C-terminal Lys. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDFKTDLRFQSSAV-K(Biotin)
MW:2834.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102996-792)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This substrate is readily hydrolyzed by MMP-8, 9 and collagenase-3 (MMP-13), Abs/Em = 325/393 nm. The hydrolysis is inhibited in a 1:1 stoichiometric fashion by the tissue inhibitors of metalloproteinases, TIMP-1, TIMP-2, and TIMP-3.
Sequence:Mca-P-Cha-G-Nva-HA-Dap(Dnp)-NH2
MW:1100.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-568)

Supplier: Anaspec Inc

Description: This peptide is a second complement component (C2), the physiological substrate for the proenzyme Cls, first complement component. The complement system is a central component of host defense but can also contribute to the inflammation seen in pathological conditions. The C1s protease of the C1 complex initiates the host defense pathway. This peptide employs 5FAM/QXL520 FRET pair for quantitation of complement enzyme activity.
Sequence:5-FAM-SLGRKIQIK(QXL 520)-NH2
MW:2019.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-284)

Supplier: Anaspec Inc

Description: Cyclo(-RGDy-K) is labeled with HiLyte™ Fluor 750 (Abs/Em=754/778 nm). This cyclic RGD peptide contains a subsituted d-Tyr instead of d-Phe on the fourth position. Substitution with Tyr results in a high affinity and selectivity for the a_vb3 integrin. Substitution with Tyr also allows for electrophilic radiohalogenation if desired.
Sequence:Cyclo[-RGDy-K(Hilyte Fluor™ 750)]
MW:1630.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 21 acetylated at Lys-14 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGG-K(Ac)-APRKQLA-GGK(Biotin)
MW:2765.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-898)

Supplier: Anaspec Inc

Description: c-Myc, the product of the c-myc proto-oncogene, is a helix-loop-helix leucine zipper phosphoprotein that regulates gene transcription in cell proliferation, cell differentiation and apoptosis. This peptide is a human c-myc epitope.
Sequence:EQKLISEEDL
MW:1203.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: Magainins are peptide antibiotics with antibacterial and antiparasitic activities, originally extracted from the skin of Xenopus laevis. Magainin 1 and 2 are closely related peptides of 23 amino acids each and differ by two substitutions. These antimicrobial peptides have broad-spectrum, non-specific activity against a wide range of micro-organisms, including viruses, gram-positive and gram-negative bacteria, protozoa, yeasts and fungi, and may also be hemolytic and cytotoxic to cancer cells. Magainin 1 is a bactericide. Both Magainin 1 and 2 exhibit inhibitory action toward Herpes simplex virus type 1(HSV-1) and HSV-2.
Sequence:GIGKFLHSAGKFGKAFVGEIMKS
MW:2409.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103000-708)

Supplier: Anaspec Inc

Description: HLA-B35-restricted epitope from Epstein-Barr Virus latent nuclear antigen 3A (458-466).
Sequence: YPLHEQHGM
MW: 1111.3 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103008-636)

Supplier: Anaspec Inc

Description: This peptide is histone H4 amino acid residues 1 to 21. It is monomethylated at Arg3, with an acetylated N-terminus and C-terminal GG linker, followed by a biotinylated Lys. Methylation of histone H4 at Arg3 is an important step in transcriptional activation and allows for subsequent acetylation of H4 tails by p300. Provided at >90% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.'
Sequence:Ac-SG-R(Me1)-GKGGKGLGKGGAKRHRKV-GGK(Biotin)
MW:2616.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-366)

Supplier: Anaspec Inc

Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103006-580)

Supplier: Anaspec Inc

Description: This glycopeptide is a MUC5AC peptide with two sites (Thr3 and Thr13) labeled with GalNAc, where the asterisk denotes GalNAc-modified residues. Mucin type O-linked glycosylation is initiated by the action of a family of UDP-GalNAc: polypeptide N-acetylgalactosaminyltransferases (ppGaNTase), which catalyze the transfer of GalNAc from the nucleotide sugar UDP-GalNAc to the hydroxyl group of either serine or threonine.
Sequence:GT-T*-PSPVPTTST-T*-SAP (* = GalNAc-modified residues)
MW:1907.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-094)

Supplier: Anaspec Inc

Description: This C-terminal biotinylated histone H3 (1-21) is monomethylated at Arg-8. Biotinylation is through the side chain of the additional lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTA-R(Me1)-KSTGGKAPRKQLA-K(Biotin)-NH2
MW:2622.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale