Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103009-742

Tau Peptide (306-336) (Repeat 3 Domain)

Catalog Number: (103009-742)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-356

AnaTag™ HiLyte™ Fluor 488 Microscale Protein Labeling Kit, Anaspec

Catalog Number: (103010-356)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488, SE is an excellent amine-reactive fluorescent labeling dye for generating protein conjugates. The spectrum of HiLyte™ Fluor488 is similar to fluorescein (FITC), resulting in an optimal match to filters designed for fluorescein.
Image Unavailable-103008-242

Human Biotin-a-CGRP,Biotin

Catalog Number: (103008-242)
Supplier: Anaspec Inc
Description: This is a biotinylated CGRP with a long chain linker attached at the N-terminus end.
Sequence:Biotin-LC-ACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2 (Disulfide bridge:2-7)
MW:4128.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-614

Mouse;Rat Beta-Amyloid (1-40)-Lys(Biotin)-NH2, Biotin

Catalog Number: (103007-614)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-102997-156

EBV (Epstein-Barr virus) CEF EBV

Catalog Number: (102997-156)
Supplier: Anaspec Inc
Description: HLA A2.1-restricted epitope from Epstein-Barr Virus latent membrane protein LMP2 (426-434).
Sequence: CLGGLLTMV
MW: 906.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-294

ACE2 Inhibitor

Catalog Number: (103007-294)
Supplier: Anaspec Inc
Description: A potent inhibitor specific for ACE2. It has a Ki of 2.8 nM.
Sequence:Ac-GDYSHCSPLRYYPWWKCTYPDPEGGG-NH2
MW:3076.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102999-364

[Lys0]-Bradykinin (Kallidin)

Catalog Number: (102999-364)
Supplier: Anaspec Inc
Description: [Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103003-048

Mouse;Rat Amylin

Catalog Number: (103003-048)
Supplier: Anaspec Inc
Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103006-278

CEF Control Peptide Pool

Catalog Number: (103006-278)
Supplier: Anaspec Inc
Description: This product contains 0.5 mg of the 32 CEF peptides for a total of 16 mg in one vial. Used in the stimulation of IFNγ release from CD8+ T cells in individuals with defined HLA types, these epitopes are useful in applications such as ELISPOT, intracellular cytokine and CTL assays.
% peak area by HPLC: ≥ 95
Storage condition: -20°C
Image Unavailable-103003-180

Human Beta-Amyloid (1-40), HiLyte™ Fluor 555

Catalog Number: (103003-180)
Supplier: Anaspec Inc
Description: This is a fluorescent (HiLyte™ Fluor 555)-labeled ß-Amyloid peptide, Abs/Em = 551/567 nm.
Image Unavailable-102996-352

[Des-Arg10]-HOE I40

Catalog Number: (102996-352)
Supplier: Anaspec Inc
Description: A potent B1 bradykinin receptor antagonist. HOE 140 helps to discriminate the roles of Bradykinin receptors.
Sequence:rRP-Hyp-G-Thi-S-(D-Tic)-Oic
MW:1148.2 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-832

Noxa BH3, Peptide 1

Catalog Number: (103007-832)
Supplier: Anaspec Inc
Description: This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.
Sequence:rrrrrrrrGAELPPEFAAQLRKIGDKVYC
MW:3555.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-906

Dansyl-X, SE [6-((5-Dimethylaminonaphthalene-1-Sulfonyl)amino) hexanoic acid, SE] ≥95% (by HPLC)

Catalog Number: (103010-906)
Supplier: Anaspec Inc
Description: Dansyl-X, SE, Synonym: Dansyl-X, NHS ester, amino-reactive building block used to prepare peptide conjugates and other bioconjugates, high efficient, Molecular Weight: 461.53, Spectral Properties: Abs/Em = 333/518 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 25 mg
Image Unavailable-103008-588

Autocamtide-2-Related Inhibitory Peptide

Catalog Number: (103008-588)
Supplier: Anaspec Inc
Description: This is a myristoylated form of Autocamtide-2-Related Inhibitory Peptide (AIP), a highly potent and specific substrate competitive inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII). AIP is derived from Autocamtide-2, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALRRQEAVDAL
MW:1708.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-372

Histone H4 (1-21) Substrate

Catalog Number: (103007-372)
Supplier: Anaspec Inc
Description: This sequence is amino acids 1 to 21 fragment of the histone 4. Histone acetyltransferase (HAT) p300/CBP catalyses the acetylation of this N-terminal tail of free histone H4 at Lys5, 8, 12, 16. Lys8 is thought to be the preferred acetylation site in H4. Determinants of interaction of p300 with histone 4 appear to be fully present on H4-21, the N-terminal region of the protein.
Sequence:SGRGKGGKGLGKGGAKRHRKV
MW:2091.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-822

Mouse;Rat Kisspeptin-10 (Kp-10)

Catalog Number: (103007-822)
Supplier: Anaspec Inc
Description: Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This peptide sequence is found in residues 45 to 54 of Metastin (also referred to as Kisspeptin-10). This peptide increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone) in prepubertal dairy heifers. This peptide is the minimal sequence needed to activate GPR54 signaling, which may function in negatively regulating CXCR4’s role in programming tumor metastasis. Specifically, Kisspeptin-10 inhibits signaling and chemotaxis induced by SDF-1.
Sequence:YNWNSFGLRF-NH2
MW:1302.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
849 - 864 of 1,910
no targeter for Bottom