You Searched For: 6000pg

Description: This is amino acids 1 to 20 fragment of the histone H3. Comparison the acetylation efficiency of different substrates showed that this peptide corresponding to the N-terminal of H3 histone has nearly identical acetylation efficiency as the H4 peptides. Acetylation of histones is generally associated with active transcription, constitutes a post-translational mark recognized by specific chromatin factors, and has been shown in vitro to prevent salt-induced folding of nucleosome arrays. Multisubunit histone acetyltransferase (HAT) complexes recognize and perform efficient acetylation on nucleosome substrates.
Sequence:ARTKQTARKSTGGKAPRKQL
MW:2183.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-506

Supplier: Anaspec Inc

Sale

Description: This peptide is derived from the Neh2 domain of nuclear factor (erythroid-derived 2)-like 2, or Nrf2. Nrf2 is a bZIP transcription factor that regulates the expression of antioxidative and cytoprotective genes. The DxETGE motif of this peptide binds Keap1 Kelch adaptor protein and displaces Nrf2 from Keap1.
Sequence:LQLDEETGEFLPIQ
MW:1631.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-894

Supplier: Anaspec Inc

Sale

Description: Mass spec standard
Sequence:DAF-L*-GSF-L*-YEYSR [L* = L(U13C6, 15N)]
MW:1581.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-434

Supplier: Anaspec Inc

Sale

Description: Insulin degrading enzyme (IDE) is considered a physiological and pathological relevant enzyme

Catalog Number: 103010-678

Supplier: Anaspec Inc

Sale

Description: A control peptide for LSKL (inhibitor of thrombospondin).
Sequence:SLLK - NH2
MW:458.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103006-078

Supplier: Anaspec Inc

Sale

Description: This is one of the cell-penetrating peptides (CPPs) derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.
Sequence: GRKKRRQRRRPPQ
MW: 1719 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: 103007-776

Supplier: Anaspec Inc

Sale

Description: This Gap 26 peptide is derived from the first extracellular loop sequence of connexin (Cx) 43. This short mimetic peptide reversibly inhibits the gap junction-dependent propagation of Ca2+ waves between tracheal airway epithelial cells.
Sequence:VCYDKSFPISHVR
MW:1550.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103007-452

Supplier: Anaspec Inc

Sale

Description: This is a biotin labeled H3K9(Ac) Histone. H3K9(Ac) is highly localized to the 5’ region of transcription start sites in human genes. Localization of H3K9(Ac)  to the transcriptionally active 5’ region of human genes suggests this peptide is essential for transcription initiation and elongation.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2764.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-960

Supplier: Anaspec Inc

Sale

Description: Melittin, a 26-residue bee venom peptide, is known to induce murine antibodies specific for its hydrophilic C-terminus of residues 20 to 26 and T-cell responses specific for its hydrophobic mid-region (residue 11 to 19). This peptide is an anti-inflammatory agent, it inhibits the lyme disease spirochete.
Sequence:GIGAVLKVLTTGLPALISWIKRKRQQ-NH2
MW:2846.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-312

Supplier: Anaspec Inc

Sale

Description: Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence:YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
MW:5729.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103003-158

Supplier: Anaspec Inc

Sale

Description: Factor Xa (FXa) is a serine endopeptidase composed of two disulfide-linked subunits

Catalog Number: 103010-622

Supplier: Anaspec Inc

Sale

Description: β-galactosidase, encoded by the lacZ gene in E

Catalog Number: 103010-472

Supplier: Anaspec Inc

Sale

Description: Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown

Catalog Number: 103010-418

Supplier: Anaspec Inc

Sale

Description: Acrylodan is a thiol-reactive dye whose fluorescence is very sensitive to conformational changes, and is well-adapted to protein structural analyses.

Catalog Number: 103011-162

Supplier: Anaspec Inc

Sale

Description: HiLyte™ Fluor 647 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy5 dyes, resulting in an optimal match to filters designed for Cy5 dyes.

Catalog Number: 103010-798

Supplier: Anaspec Inc

Sale

Description: C18G is a synthetic α-helical peptide derived from human platelet factor IV. This peptide was found to be antibacterial and is active against Salmonella.
Sequence:ALYKKLLKKLLKSAKKLG
MW:2043.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103007-328

Supplier: Anaspec Inc

Sale