You Searched For: Heat Block

Catalog Number: (103003-130)

Supplier: Anaspec Inc

Description: This Gastrin peptide is biotinylated at the N-terminus. It is similar to human Gastrin-17. However, native Gastrin-17 contains pyroglutamate at its N-terminus (Pyr), while this peptide contains Glutamate (E) at its N-terminus to allow for biotin coupling.
Sequence: Biotin-EGPWLEEEEEAYGWMDF-NH2
MW: 2342.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103003-274)

Supplier: Anaspec Inc

Description: TET 830 modified/T-helper epitope from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.
Sequence:AQYIKANSKFIGITEL
MW:1797.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.

Catalog Number: (103010-996)

Supplier: Anaspec Inc

Description: mBBr is one of the most popular thiol-reactive fluorescent tags, and is widely used to detect various thiol-containing biomolecules such as glutathione in cells. It is fluorogenic upon reacting with thiol-containing molecules.

Sale

Catalog Number: (102999-620)

Supplier: Anaspec Inc

Description: In Alheimer's Disease brains, plaques contain amino-terminal truncated beta-Amyloid peptides including the alpha secretase-generated p3 fragments, beta-Amyloid 17-40 and 17-42. They were shown to induce pro-inflammatory cytokine and chemokine production in vitro and in vivo.

Sale

Catalog Number: (103008-962)

Supplier: Anaspec Inc

Description: TACE (tumor necrosis factor-alpha converting enzyme), α-secretase, or ADAM17 is a member of the ADAM family of proteases that contain both disintegrin and metalloprotease (catalytic) domains

Sale

Catalog Number: (103006-540)

Supplier: Anaspec Inc

Description: This peptide is histone H4 amino acids 1 to 21, acetylated at Lys-5 and at the N-terminus. This peptide also contains a C-terminal GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRG-K(Ac)-GGKGLGKGGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: The native peptide ARKRERTYSFGHHA (29944-1) is a synthetic substrate for AKT/PKB/Rac-protein kinases. Phophorylation is at the Ser site (Km = 3.9 µM). It also competitively inhibits histone H2B phosphorylation (Ki = 12 µM) by AKT.
Sequence:Biotin-ARKRERTYSFGHHA
MW:1942.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-230)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 69 to 90. It is trimethylated at lysine 79 with a biotinylated lysine added to the C-terminus. The trimethylation of histone H3 at lysine 79 is found in the pericentromeric heterochromatin regions where active genes are not present. Provided at >90% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDF-K(Me3)-TDLRFQSSAV-K(Biotin)
MW:2876.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-660)

Supplier: Anaspec Inc

Description: Cathepsin E is a non-lysosomal aspartic proteinase of the pepsin superfamily, playing an important role in host defense against cancer cells in addition to it’s roles in protein degradation, antigen processing etc

Sale

Supplier: Anaspec Inc

Description: AT-selective minor groove binder that exhibits nice fluorescence enhancement in the presence of DNA.

Catalog Number: (103009-058)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-25) with acetylation at Lys20. It is biotinylated through a C-terminal GSGSK linker. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHR-K(Ac)-VLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This is N-terminal biotin labeled Glucagon (1-29). Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycaemia.
Sequence: Biotin-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3709.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103008-214)

Supplier: Anaspec Inc

Description: Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.
Sequence:GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
MW:4551.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-660)

Supplier: Anaspec Inc

Description: This is a histone 4 peptide acetylated at lysine 5. This form of histone acetylated lysine is found to be enriched at the 5' ends of the coding regions and is known to enhance gene expression.
Sequence:SGRG-K(Ac)-GGKGLGKGGAKRHRK
MW:2034.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-172)

Supplier: Anaspec Inc

Description: β-Secretase is a membrane-anchored aspartic protease existing in acidic subcellular vesicles

Sale