Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-102998-448

Human Calcitonin Peptide

Supplier: Anaspec Inc
Description: Human calcitonin reduces blood calcium, opposing the effects of parathyroid hormone (PTH). It stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.
Sequence: CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
MW: 3417.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-103007-678

Myristolated PKC Zeta

Catalog Number: (103007-678)
Supplier: Anaspec Inc
Description: This is a myristoylated PKCζ pseudosubstrate-derived ζ-inhibitory peptide (ZIP) found to inhibit an atypical type of Protein Kinase C ζ (zeta)
Sequence:Myr-RLYRKRIWRSAGR
MW:1928.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-510

BDC2.5 mimotope 1040-31

Catalog Number: (103007-510)
Supplier: Anaspec Inc
Description: This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone BDC2.5. It can stimulate BDC2.5 cells with cells showing good response to this mimotope. 1040-31 peptide is specific for BDC2.5 TCR Tg+ (transgenic) T cells. This peptide is also known as p31.
Sequence: YVRPLWVRME
MW: 1348.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103010-580

SensoLyte® 520 Cathepsin G Assay Kit Fluorimetric, AnaSpec, Inc.

Catalog Number: (103010-580)
Supplier: Anaspec Inc
Description: Cathepsin G is the serine protease released by neutrophils upon their activation
Image Unavailable-103010-242

SensoLyte® 520 MMP-13 Assay Kit (Fluorimetric), AnaSpec

Catalog Number: (103010-242)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components
Image Unavailable-103010-768

5(6)-Carboxyfluorescein N-hydroxysuccinimide ester (5/6-FAM SE)

Supplier: Anaspec Inc
Description: Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Image Unavailable-103004-984

Human Recombinant alpha-Synuclein (from E. coli), HiLyte Fluor® 488

Catalog Number: (103004-984)
Supplier: Anaspec Inc
Description: The recombinant human a-synuclein (1-140) (GenBank Accession # NP_000336) was expressed and purified from E. coli and conjugated with the fluorescence dye HiLyte FluorTM 488. This protein is produced without affinity tag.
α-Synuclein is a major component of Lewy bodies in the affected neurons in Parkinson's disease. This protein has a mass of 14.5 kDa (140 amino acids long) and consists of a conserved degenerative amino-terminal domain and an acidic carboxyl-terminal with higher sequence divergence. α-Synuclein is predominantly expressed in brain, specifically in cerebellum, thalamus, neocortex, hippocampus, and striatum regions. Other tissues express α-Synuclein at very low levels. The physiological role of α-synuclein is not yet well understood. However, the presence of imperfect KTKEGV lipid interacting repeats suggests that it may be involved in synaptic vesicle homeostasis.
Image Unavailable-103010-452

SensoLyte® Luminescent Alkaline Phosphatase Assay Kit Luminometric

Catalog Number: (103010-452)
Supplier: Anaspec Inc
Description: SensoLyte® Luminescent Alkaline Phosphatase Assay Kit provides highly sensitive chemiluminescent substrate to quantify alkaline phosphatase activity in solutions, in cell extracts, in live cells.
Image Unavailable-103010-924

7-Hydroxy-4-methylcoumarin-3-acetic acid, succinimidyl ester

Catalog Number: (103010-924)
Supplier: Anaspec Inc
Description: 7-Hydroxy-4-methylcoumarin-3-acetic acid, SE is a blue fluorophore that has pH-dependent and environment-sensitive fluorescence. It is widely used for preparing bioconjugates of blue fluorescence.
Image Unavailable-103008-172

Cyclo-[GRGESP]

Catalog Number: (103008-172)
Supplier: Anaspec Inc
Description: This peptide is a negative control for cGRGDSP
Sequence:Cyclo-[GRGESP]
MW:582 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-344

GRGESP, AnaSpec

Catalog Number: (102996-344)
Supplier: Anaspec Inc
Description: An inactive control for the integrin-binding peptide, GRGDTP.
Sequence:GRGESP
MW:601.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-398

Chicken OVA (323-339)

Catalog Number: (103007-398)
Supplier: Anaspec Inc
Description: This peptide is amino acids 323 to 339 amidated fragment of ovalbumin (OVA), the H-2b-restricted OVA class II epitope. This peptide is recognized by many T cells because it contains multiple T cell epitopes. This OVA fragment contains a nested set of CD4+ T cell epitopes. OVA 323 to 339 can be presented by I-Ad in at least three binding registers. The residues 327 to 333 are critical for peptide binding to I-Ad.
Sequence: ISQAVHAAHAEINEAGR-NH2
MW: 1773 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103008-082

Human IGRP Catalytic Subunit-related Protein (206-214)

Catalog Number: (103008-082)
Supplier: Anaspec Inc
Description: This peptide corresponds to residues 206–214 of murine islet-specific glucose-6-phosphatase catalytic subunit–related protein (IGRP). This peptide is T cells specific for proinsulin and IGRP induces diabetes in non-obese diabetic (NOD) mice.
Sequence: VYLKTNVFL
MW: 1096.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103008-280

[Lys(Me1)36]-Histone H3 (26-46)-K,Biotin

Catalog Number: (103008-280)
Supplier: Anaspec Inc
Description: This peptide is a synthetic peptide corresponding to amino acids 26 to 46 of human histone H3. It is also monomethylated at lysine-36, followed by a biotinylated lysine. The methylation of histone H3 at lysine 36 (K36) has recently been shown to be associated with RNA polymerase II (Pol II) elongation in Saccharomyces cerevisiae. Histone methylation also plays a key role in the regulation of chromatin structure and function. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RKAAPATGGV-K(Me1)-KPHRYRPGTV-K(Biotin)
MW:2616.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-106

Human Cholecystokinin (26-33)

Catalog Number: (102996-106)
Supplier: Anaspec Inc
Description: C-terminal sulfated and amidated octapeptide Cholecystokinin (sulfated CCK-8) has the full biological action of the full-length 33-amino acid long Cholecystokinin (CCK). CCK acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
Sequence: D-Y(SO3H)-MGWMDF-NH2
MW: 1143.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103007-308

Cyclo (-RADfK-), RGD Negative Control

Catalog Number: (103007-308)
Supplier: Anaspec Inc
Description: This peptide is a negative control for the cyclo (-RGDfK), the RGD peptide. RGD peptides are modulators of cell adhesion and are recognized by several members of the integrin family. This peptide has low affinity binding to integrin peptides.
Sequence:Cyclo(-RADfK-)
MW:617.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
689 - 704 of 1,910
no targeter for Bottom