Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This substrate is hydrolyzed rapidly by MMP-13, but slowly by MMP-1, 2, 3, 8, 9 and 12, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PLGLWArK(5-FAM)-NH2
MW:1789.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-238

Supplier: Anaspec Inc

Sale

Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-180

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H4 amino acids 1 to 16, acetylated at Lys-16 and at the N-terminus. This peptide also contains a GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-536

Supplier: Anaspec Inc

Sale

Description: Serine/threonine phosphatase substrate.
Sequence:KR-pT-IRR
MW:909 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102998-170

Supplier: Anaspec Inc

Sale

Description: Beta-amyloid 1-55 is the the 672-726 fragment of APP.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Molecular Weight: 5982.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-612

Supplier: Anaspec Inc

Sale

Description: A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 2 units of gammaGlu-Cys.
Sequence:(γE-C)2-G
MW:540.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-386

Supplier: Anaspec Inc

Sale

Description: Beclin-1 peptide is the HIV-1 Nef binding portion of full-length human Beclin-1 protein (amino acids 267-299). Beclin-1 protein is an autophagy inducing agent that may trigger cellular adaptation, survival or cell death. When conjugated to the cell-permeable peptide, it can successfully enter cells and induce autophagy. RELATED PRODUCTS:Beclin-1, Cat# 65466Tat-Beclin-1, scrambled, Cat# 65468
Sequence: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
MW: 3741.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: 103009-976

Supplier: Anaspec Inc

Sale

Description: 5-FAM cadaverine is an excellent building block to prepare fluorescent ligands for receptor binding assays. Additionally, we have proven that the fluorescein cadaverine derivative is also a good transglutaminase substrate for site-specific protein labeling like FITC cadaverine.

Catalog Number: 103011-020

Supplier: Anaspec Inc

Sale

Description: HiLyte™ Fluor 750 hydrazide is a carbonyl-reactive fluorescent labeling dye. It can be used for labeling glycoproteins such as HRP.

Catalog Number: 103010-950

Supplier: Anaspec Inc

Sale

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide contains 5-FAM only and is similar to the proteolytic product of the 520 MMP FRET substrates. It can be used to set up the fluorescence standard curve. Abs/Em = 494/521 nm.
Sequence:5-FAM-PL
MW:586.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103005-948

Supplier: Anaspec Inc

Sale

Description: This peptide is composed of gp91phox sequence linked to the human immunodeficiency virus-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly.
Sequence: YGRKKRRQRRRCSTRIRRQL-NH2
MW: 2673.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: 103007-746

Supplier: Anaspec Inc

Sale

Description: This peptide, derived from the BH3 domain of Bak (Flu-BakBH3), has been shown to have high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function.
Sequence:GQVGRQLAIIGDDINR
MW:1724.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-878

Supplier: Anaspec Inc

Sale

Description: This hybrid peptide named colivelin was synthesized to potentiate the neuroprotective effect of humanin (HN). Colivelin is composed of Activity-Dependent Neurotrophic Factor (ADNF) C-terminally fused to AGA-(C8R) HNG17, a potent HN derivative. Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease (FAD)-causative genes and beta-amyloid (1-43). Intraperitoneally administered colivelin suppresses memory impairment and might serve as a novel drug candidate for treatment of Alzheimer's disease.
Sequence:SALLRSIPAPAGASRLLLLTGEIDLP
MW:2645.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-098

Supplier: Anaspec Inc

Sale

Description: Cell-permeant DNA minor groove binding dye

Catalog Number: 103011-142

Supplier: Anaspec Inc

Sale

Description: This is a cell adhesive peptide (RGDC), capable of binding to surface Zr alkoxide complexes through (maleimido) alkylcarboxylate intermediates. This peptide may be used to stimulate human osteoblast attachment.
Sequence:RGDC
MW:449.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-600

Supplier: Anaspec Inc

Sale

Description: 7-Amino-4-methylcoumarin is used to produce fluorogenic substrates

Catalog Number: 103003-516

Supplier: Anaspec Inc

Sale