Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103002-990

ERKtide

Catalog Number: (103002-990)
Supplier: Anaspec Inc
Description: ERKtide is a peptide substrate for ERK2. Extracellular regulated protein kinase 2 (ERK2) is a eukaryotic protein kinase whose activity is regulated by mitogenic stimuli.
Sequence:ATGPLSPGPFGRR
MW:1312.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-160

Rat Rat Renin Inhibitor Peptide

Catalog Number: (103003-160)
Supplier: Anaspec Inc
Description: A specific rat renin inhibitor.
Sequence:Ac - HPFV - (Sta) - LF - NH2
MW:957.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-102996-720

Mouse;Rat Beta-Amyloid (1-42)

Supplier: Anaspec Inc
Description: This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103010-130

SensoLyte® ADHP Hydrogen Peroxide Assay Kit (Fluorimetric), AnaSpec Inc.

Catalog Number: (103010-130)
Supplier: Anaspec Inc
Description: Hydrogen peroxide is involved in a number of biological events, in particular, free radical-induced biochemical reactions.
Image Unavailable-103010-470

SensoLyte® MUG β-Galactosidase Assay Kit (Fluorimetric), AnaSpec

Catalog Number: (103010-470)
Supplier: Anaspec Inc
Description: β-galactosidase, encoded by the lacZ gene in E
Image Unavailable-103003-754

Human Angiotensin II Substrate

Catalog Number: (103003-754)
Supplier: Anaspec Inc
Description: This is a tyrosine phosphorylated angiotensin II peptide with a substrate sequence specificity for chymase to act. This is an octapeptide hormone that is formed as a result of the action of human heart chymase, a chymotrypsin-like serine protease on the Phe-His bond of Angiotensin I. The ideal susbtrate for human heart chymase should contain this peptide sequence, and has been demonstrated that the Pro-Phe sequence in P2-P1 positions of peptide substrates is highly favored by leukocyte chymotrypsin-like proteinases such as chymases and cathepsin G.
Sequence: DRV-pY-IHPF
MW: 1126.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103010-480

SensoLyte® 520 Thiol Quantitation Assay Kit (Fluorimetric), AnaSpec

Catalog Number: (103010-480)
Supplier: Anaspec Inc
Description: Thiols, compounds that contain sulfhydryl group, are powerful reducing agents capable of acting as antioxidants, enzyme cofactors, and neuromodulators.
Image Unavailable-103010-634

SensoLyte® Thioflavin T β-Amyloid (1-40) Aggregation Kit, AnaSpec

Catalog Number: (103010-634)
Supplier: Anaspec Inc
Description: The SensoLyte® ThT β-Amyloid (1-40) Aggregation kit provides a convenient and standard method to measure Aβ40 aggregation using Thioflavin T dye
Image Unavailable-103007-070

Cathepsin S Substrate, AMC (7-amino-4-methylcoumarin)

Catalog Number: (103007-070)
Supplier: Anaspec Inc
Description: Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases.
This peptide is a cathepsin S substrate fluorescently labeled with AMC (Ex/Em=354 nm/442 nm). It can be used to measure cathepsin S activity.
Sequence:Ac-KQKLR-AMC
MW:871.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-512

Human PLP

Catalog Number: (103006-512)
Supplier: Anaspec Inc
Description: This is amino acid residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
Sequence: HCLGKWLGHPDKF
MW: 1537.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103006-002

Human ACE Substrate 2

Catalog Number: (103006-002)
Supplier: Anaspec Inc
Description: An ACE-2 (Angiotensin I-converting enzyme 2) fluorescent substrate. Complete hydrolysis of 0.04 mM results in a 300-fold fluorescence increase over background. Max Abs/Em=325/393 nm upon cleavage of substrate.
Sequence: Mca-APK(Dnp)
MW: 696.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103010-936

HiLyte™ Fluor 555 amine fluorescent dye

Catalog Number: (103010-936)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 555 amine is a carbonyl-reactive fluorescent labeling dye that generates the conjugates that are only slightly red-shifted compared to those of Cy3 dye, resulting in an optimal match to filters designed for Cy3 dyes.
Image Unavailable-103008-444

Gag Spacer Peptide P1

Catalog Number: (103008-444)
Supplier: Anaspec Inc
Description: This peptide sequence is derived from the Gag spacer peptide p1 that is encoded in the frameshift region of human immunodeficiency virus type 1 (HIV-1).
Sequence:HHHHHHIIKIIK
MW:1549.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-190

CREBtide

Catalog Number: (103003-190)
Supplier: Anaspec Inc
Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:KRREILSRRPSYR
MW:1717 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-330

Influenza Virus Nucleoprotein (311-325)

Catalog Number: (103007-330)
Supplier: Anaspec Inc
Description: This peptide is amino acids 311 to 325 fragment of the influenza virus nucleoprotein (NP). This bona fide MHC class II restricted epitope from influenza virus was used to study the host immunoresponse during the infection. This peptide elicits the strongest gamma interferon (IFN-gamma) production in the intracellular cytokine assays. It does not stimulate CD8 T-cells in mice.
Sequence:QVYSLIRPNENPAHK
MW:1767 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-596

Human;Mouse;Rat Beta-Amyloid (25-35), HiLyte™ Fluor 488

Catalog Number: (103007-596)
Supplier: Anaspec Inc
Description: This is amino acids 25 to 35 fragment of beta-amyloid peptide labeled with HiLyte™ Fluor 488, Abs/Em=503/528 nm.
Sequence: HiLyte™ Fluor 488-GSNKGAIIGLM
Molecular Weight: 1416.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
705 - 720 of 1,910
no targeter for Bottom