You Searched For: Hytest Ltd


1,910  results were found

SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103010-284)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-8 (neutrophil collagenase) is synthesized by neutrophils and stored in the specific granules until it is secreted.

Human MMP-8 is a full length pro-enzyme isolated from stimulated human neutrophil granulocytes. Proenzyme can be activated by incubating with 1 mM APMA at 37°C for 1 hr. Its activity can be measured in FRET-based enzymatic assays. 10-20 ng of enzyme is sufficient for FRET-based assay.


Catalog Number: (103010-986)
Supplier: Anaspec Inc
Description: Tetramethylrhodamine iodoacetamides (TMRIA) are thiol-selective reactive dyes that are used to label proteins via the cysteine residues. 5-TMRIA, the pure 5-isomer of TMRIA, is increasingly preferred for some particular applications since the mixed isomers of TMRIA may give different results from batch to batch due to the varying ratios and different reactivities of the two isomers. For example, 5-TAMRA is reported to predominantly label SH-1 (Cys-707) of the myosin heavy chain in skinned muscle fibers.


Catalog Number: (103010-164)
Supplier: Anaspec Inc
Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components


Catalog Number: (103011-412)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 532 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye.


Supplier: Anaspec Inc
Description: This peptide is a histone H3 trimethylated at lysine 4 and is associated with transcription, specifically marking the transcription start site of actively transcribed genes. This peptide can be demethylated by Jumonji AT-rich interactive domanin 1 (JARID1) or by lysine demethylase 5 (KDM5) family of lysine demethylases.
Sequence: ART-K(Me3)-QTARKSTGGKAPRKQLA
MW: 2296.6 Da
% peak area by HPLC: 95
Storage condition: -20 °C

Catalog Number: (102998-434)
Supplier: Anaspec Inc
Description: Centrally administered N-terminal fragments of ACTH (1-10, 4-10, 4-9) display convulsant properties in rabbits.
Sequence: SYSMEHFRWG
MW: 1299.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: Fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Catalog Number: (103010-898)
Supplier: Anaspec Inc
Description: DEAC, acid is a useful blue fluorescent building block for labeling amine-containing biomolecules.


Catalog Number: (103011-050)
Supplier: Anaspec Inc
Description: DABCYL C2 maleimide is an excellent thiol-reactive building block for developing DABCYL-based FRET probes.


Catalog Number: (103009-506)
Supplier: Anaspec Inc
Description: This is histone H3 (1-21) dimethylated at Lys9. Methylation of Lys 9 is associated with transcriptionally silent chromatin. Histone H3 mono- and dimethylated at Lys 9 localize specifically to silent domains within euchromatin while histone H3 trimethylated at this residue localizes to pericentric heterochromatin.
Sequence:ARTKQTAR-K(Me2)-STGGKAPRKQLA
MW:2282.6 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103010-670)
Supplier: Anaspec Inc
Description: Tobacco Etch Virus (TEV) proteinase is widely used to remove fusion tags from recombinant proteins


Catalog Number: (103009-388)
Supplier: Anaspec Inc
Description: This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Catalog Number: (103007-132)
Supplier: Anaspec Inc
Description: This synthetic peptide corresponds to amino acids 20 to 42 of b-Amyloid protein.
Sequence: FAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 2217.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-172)
Supplier: Anaspec Inc
Description: This short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin. Co-administration of the peptide and insulin to the abdominal skin of diabetic rats results in elevated systemic levels of insulin and suppresses serum glucose levels. This peptide creates a transient opening in the skin barrier to enable macromolecular drugs to reach systemic circulation.
Sequence:ACSSSPSKHCG
MW:1063.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103010-146)
Supplier: Anaspec Inc
Description: HCV protease is identified as an important drug-screening target.


Catalog Number: (103007-242)
Supplier: Anaspec Inc
Description: The is a reverse sequence of LL-37 used in control experiments.
Sequence: SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
721 - 736 of 1,910
no targeter for Bottom