You Searched For: Inorganic+Boron+Compounds+

Description: 7-Hydroxycoumarin-3-carboxylic acid is one of the most popular blue fluorophores for labeling proteins and nucleic acids mostly through the in situ formation of its succinimidyl ester (81206). This coumarin is also increasingly used to label peptides, nucleotides and carbohydrates.

Catalog Number: 103010-890

Supplier: Anaspec Inc

Sale

Description: Tetramethylrhodamine-6 C2 maleimide is a good alternative to tetramethylrhodamine-6-maleimide with excitation/emission wavelength at 544/572 nm. Its spectral characteristics are very close to those of tetramethylrhodamine-6-maleimide (+2 nm). It is 40% less expensive compared to tetramethylrhodamine-6-maleimide, and can be used for thiol modification of proteins, antibodies and peptides.

Catalog Number: 103011-004

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H3 amino acid residues 1 to 21. It is asymmetrically dimethylated at arginine 8 with both methyl groups added to one nitrogen of the guanidinium group, and contains a C-terminal biotinylated lysine.
Sequence:ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2
MW:2636.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-616

Supplier: Anaspec Inc

Sale

Description: The native peptide, PLARTLSVAGLPGKK (cat# 22511), is a selective substrate for CaM kinase II and protein kinase C. It is a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. The relative Vmax/Km ratios of the peptide for different kinases are 100 for CaMK II, 22 for protein kinase C, 2 for phosphorylase kinase, and 0.5 for myosin light chain kinase respectively.
Sequence:PLARTLSVAGLPGKK
MW:1507.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102996-268

Supplier: Anaspec Inc

Sale

Description: This is a fluorescent (FAM)-labeled Endothelin 1 peptide, Abs/Em = 494/521 nm.
Sequence:FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2850.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102996-804

Supplier: Anaspec Inc

Sale

Description: PMDM6-F is a fluorescent-labeled probe for MDM2-binding assay.
Sequence: 5-FAM-(β-A)-(β-A)-FM-Aib-pY-(6-Cl-DL-Trp)-E-Ac3c-LN-NH2
MW: 1784.3Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-616

Supplier: Anaspec Inc

Sale

Description: This sequence is amino acids 1 to 21 fragment of the histone 4, acetylated at the N-terminus and biotinylated on the side chain of Lys. A GG spacer has been added on the C-terminus of Lys.
Sequence:Ac-SGRGKGGKGLGKGGAKRHRKV-GGK(Biotin)
MW:2602.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-396

Supplier: Anaspec Inc

Sale

Description: This b-amyloid (1-42) contains the Flemish (D23N) mutation where Asp23 is replaced by Asn.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103006-670

Supplier: Anaspec Inc

Sale

Description: This 20-residue peptide, a major pathogenic T-cell epitope (161–180), is present in the first homologous repeat of the interphotoreceptor retinoid binding protein peptide (IRBP). It has been shown to induce posterior uveitis (EAU).
Sequence:SGIPYIISYLHPGNTILHVD
MW:2209.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103002-746

Supplier: Anaspec Inc

Sale

Description: This amino acids 11 to 22 fragment of b-amyloid is capable of forming well-organized amyloid fibrils in vitro, similar to the pathogenic ones found in amyloidosis. Analysis of the structural properties of one monomer of b-amyloid (11-22) as well as of the aggregation mechanisms for four chains of b-amyloid (11-22) showed that the system assembles rapidly into a random globular state that evolves into three- and four-stranded antiparallel beta-sheets. The aggregation process is considerably accelerated by the presence of preformed dimers.
Sequence: EVHHQKLVFFAEDVG
Molecular Weight: 1755 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103007-538

Supplier: Anaspec Inc

Sale

Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:5-FAM-KRREILSRRPSYR
MW:2075.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103003-138

Supplier: Anaspec Inc

Sale

Description: This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Sequence:GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
MW:4433.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-562

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H4 (1-21), acetylated at lysine 12. The N-terminus contains a C-terminus GG linker followed by a biotinylated lysine. The acetylation of histone H4 plays a crucial role in structural changes that amplifies the binding of transcription factors to their recognition sites within the nucleosomes. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-544

Supplier: Anaspec Inc

Sale

Description: This is a type I signal peptidase (SPase1) substrate peptide labeled with EDANS/ DABCYL FRET pair, and contains a crucial cleavage site derived from the C-terminal region of the Staphylococcus epidermidis pre-SceD protein. Abs/Em = 340/490 nm.
Sequence:Dabcyl-AGHDAHASET-Edans
MW:1494.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-586

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H3 amino acid residues 1-21. It is dimethylated at lysine 18 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2
MW:2750.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-322

Supplier: Anaspec Inc

Sale

Description: Erktide is a peptide substrate for ERK2 (extracellular regulated protein kinase 2) whose activity is regulated by mitogenic stimuli.
Sequence:IPTTPITTTYFFFK
MW:1677 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-980

Supplier: Anaspec Inc

Sale