Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-102996-450

Plasminogen activator acrosine Substrate, AFC (Antibody-fluorophore conjugate)

Catalog Number: (102996-450)
Supplier: Anaspec Inc
Description: This is a fluorescent plasminogen activator acrosine substrate, Abs/Em=380/500.
Sequence:Z-GGR-AFC
MW:633.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-898

7-(Diethylamino)coumarin-3-carboxylic acid

Catalog Number: (103010-898)
Supplier: Anaspec Inc
Description: DEAC, acid is a useful blue fluorescent building block for labeling amine-containing biomolecules.
Image Unavailable-103007-136

Human Beta-Amyloid (1-15)-Lys16, HiLyte™ Fluor 488

Catalog Number: (103007-136)
Supplier: Anaspec Inc
Description: This peptide is the beta-Amyloid peptide, residues 1 to 16 labeled with HiLyte™ Fluor 488 on the Lys16, Abs/Em =501/527.
Sequence: DAEFRHDSGYEVHHQ-K(HiLyte™ Fluor 488)
Molecular Weight: 2311.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103008-590

Autocamtide-3-Related Inhibitory Peptide

Catalog Number: (103008-590)
Supplier: Anaspec Inc
Description: This is a myristoylated form of Autocamtide-3-Derived Inhibitory Peptide (AC3-I), a highly specific inhibitor of Calmodulin-Dependent Protein Kinase ll (CaMKII) that is resistant to proteolysis. AC3-I is derived from Autocamtide-3, a substrate for CaMKII, with the Thr-9 phosphorylation site substituted with Ala.
Sequence:Myr-KKALHRQEAVDAL
MW:1689.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-970

Penetratin-Arg

Catalog Number: (103009-970)
Supplier: Anaspec Inc
Description: Penetratin-Arg is a cell-penetrating peptide (CPP) that is derived from the 3rd helix of Drosophila Antennapedia homeodomain protein. Penetratin-Arg is the same as Penetratin except that Lysine residues were substituted with Arginines. It forms an alpha-helix structure in lipid environment and can permeate cell membrane at low micromolar concentration without significantly affecting membrane. CPP can be conjugated with large molecules and used as a drug delivery vehicle. R
Sequence:RQIRIWFQNRRMRWRR
MW:2358.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-216

1,1'-Di-n-octadecyl-3,3,3',3'-tetramethylindocarbocyanine iodide fluorescent dye

Catalog Number: (103010-216)
Supplier: Anaspec Inc
Description: A lipophilic membrane stain that diffuses laterally to stain the entire cell; Its fluorescence is significantly enhanced upon membrane incorporation.
Image Unavailable-103007-566

Human Beta-Amyloid (11-40), FAM (Carboxyfluorescein)

Catalog Number: (103007-566)
Supplier: Anaspec Inc
Description: This Abeta peptide (11-40) is FAM-labeled (Abs/Em=494/521 nm). FAM is preferred over FITC because of its photo- and chemical stability.
Sequence: 5-FAM-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3510 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103008-436

Gap 27

Catalog Number: (103008-436)
Supplier: Anaspec Inc
Description: This peptide is a scrambled version of the Gap 27 domain of Connexin.
Sequence:REKIITSFIPT
MW:1304.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103010-360

AnaTag™ HiLyte™ Fluor 647 Microscale Protein Labeling Kit (Ultra Convenient), AnaSpec

Catalog Number: (103010-360)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 647 acid, SE (Ex/Em=647 nm/ 679 nm) is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy® 5 dyes, resulting in an optimal match to filters designed for Cy®5 dyes
Image Unavailable-103007-172

Transdermal Peptide

Catalog Number: (103007-172)
Supplier: Anaspec Inc
Description: This short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin. Co-administration of the peptide and insulin to the abdominal skin of diabetic rats results in elevated systemic levels of insulin and suppresses serum glucose levels. This peptide creates a transient opening in the skin barrier to enable macromolecular drugs to reach systemic circulation.
Sequence:ACSSSPSKHCG
MW:1063.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102999-784

Hyalophora cecropia Cecropin A Peptide

Supplier: Anaspec Inc
Description: Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.
Sequence:KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
MW:4003.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103008-598

Plasmodium Plasmepsin V FRET Substrate, DABCYL-EDANS

Catalog Number: (103008-598)
Supplier: Anaspec Inc
Description: This FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved Plasmodium Export Element (PEXEL) motif of Histidine-Rich Protein II (HRPII). PMV is an ER aspartic protease that recognizes and cleaves the RXL sequence within the PEXEL motif of proteins exported by human malaria parasite Plasmodium falciparum, allowing them to translocate into host erythrocytes.
Sequence:Dabcyl-LNKRLLHETQ-EDANS
MW:1751.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-890

[Lys(Ac)5]-Histone H4 (1-25)-GSGSK,Biotin

Catalog Number: (103009-890)
Supplier: Anaspec Inc
Description: This peptide is histone H4 (1-25) with acetylation at Lys5. It is biotinylated through a C-terminal GSGSK linker. Acetylation at Lys5 plays a role in histone deposition and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GGKGLGKGGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-880

Human Peptide Myelin Oligodendrocyte Glycoprotein, AnaSpec

Catalog Number: (103006-880)
Supplier: Anaspec Inc
Description: This 11 mer peptide myelin oligodendrocyte glycoprotein ( pMOG) ( 44–54) represents the core binding epitope for MOG-specific CD8+ T cells. This is the minimal, functionally constant, length of the MOG (35–55) peptide that binds to CD8+ MOG-specific T cells and stimulates T cell proliferation in vitro.
Sequence: FSRVVHLYRNG
MW: 1347.6 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103011-236

HiLyte™ Fluor 405 acid, SE fluorescent dye

Catalog Number: (103011-236)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 405 is a blue fluorescent dye with Ex/Em = 404/428 nm, spectrally similar to Alexa Fluor™ 405 and DyLight Fluor™ 405 dyes.
Image Unavailable-103009-742

Tau Peptide (306-336) (Repeat 3 Domain)

Catalog Number: (103009-742)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
609 - 624 of 1,910
no targeter for Bottom