Human Beta-Amyloid (1-40) HCl

Supplier: Hytest Ltd
Ratings: (No Reviews)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

AS-20698 AS-23211
102996-092EA 558.31 USD
102996-092 102999-432
Human Beta-Amyloid (1-40) HCl
Proteins and Peptides

All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Molecular Weight: 4329.9+36.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR