You Searched For: Hytest Ltd


1,910  results were found

SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103010-860)
Supplier: Anaspec Inc
Description: Although FITC reagents have been predominantly used to prepare green fluorescent bioconjugates, the low photostability and pH-dependent fluorescence of FITC bioconjugates make researchers search for alternative fluorophores in bioconjugations. Among green fluorophores, CR110 reagents give more photostable and pH-independent bioconjugates that have the absorption maximum around the preferred 488 nm excitation wavelength.


Catalog Number: (103007-166)
Supplier: Anaspec Inc
Description: This peptide is amino acids 48 to 57 fragment of TAT with an additional cysteine residue at the N-terminus. This peptide contains the protein transduction domain (PTD) of the HIV Tat protein that inhibits HSV-1 entry. The addition of a cysteine residue to the N-terminus of the Tat-PTD (Tat-C peptide) improves the antiviral activity against HSV-1 and HSV-2. Tat-C acts extracellularly, blocking entry of adsorbed virus immediately without eluting virions.
Sequence: CGRKKRRQRRR
MW: 1499.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (102996-072)
Supplier: Anaspec Inc
Description: Magainin 2 assumes an amphiphilic helix when bound to acidic phospholipids, forming a pore composed of a dynamic, peptide-lipid supramolecular complex.
Sequence:GIGKFLHSAKKFGKAFVGEIMNS
MW:2466.9 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-370)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1-21. It is monomethylated at arginine 17 with a C-terminal GG linker followed by a biotinylated lysine. The methylation of histone H3 at arginine 17 is linked with gene activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAP-R(Me1)-KQLA-GGK(Biotin)-NH2
MW:2736.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-964)
Supplier: Anaspec Inc
Description: This peptide is a synthetic peptide corresponding to amino acids 1-21 of human histone H3. It is trimethylated at lysine-4 with a C-terminal Gly-Gly linker followed by a biotinylated Lys. The trimethylation of histone H3 at lysine 4 [H3K4(Me3)] shows cell state and lineage potential by differentiating genes that are expressed, poised for expression, or repressed. H3K4(Me3) also labels imprinting control regions.
Sequence:ART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin)-NH2
MW:2765.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103009-608)
Supplier: Anaspec Inc
Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is mono-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me1)-VLRDNIQGIT-WGK(biotin)
MW:3156.7 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Anaspec Inc
Description: Somatostatin [SST, GHIH (growth hormone-inhibiting hormone) or SRIF (somatotropin release-inhibiting factor)] is a cyclic peptide hormone existing as two isoforms and produced in the pancreas islet, GI tract and the central nervous system. Tetradecapeptide Somatostatin-14 (SRIF-14, the originally identified somatostatin) and the 28-amino acid Somatostatin-28 (SRIF-28) have similar biological activities but differ in their potency. Somatostatins regulate the endocrine system: they inhibit the release of growth hormone in contrast to Growth Hormone Factor (GRF), which stimulates the release of growth hormone. They also inhibit the release of prolactin and thyrotropin, peptide hormones from the pituitary gland and glucagon and insulin from the pancreas. They control the secretion of gut hormones and function as neurotransmitters.
Sequence: SANSNPAMAPRERKAGCKNFFWKTFTSC (Disulfide bridge: 17-28)
MW: 3148.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103010-586)
Supplier: Anaspec Inc
Description: Histone deacetylase (HDAC) enzymes act as transcriptional repressors of genes through the deacetylation of lysine residues on histone proteins


Catalog Number: (103010-806)
Supplier: Anaspec Inc
Description: 6-TET, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.


Catalog Number: (103010-702)
Supplier: Anaspec Inc
Description: pH-dependent fluorescence; Maximum intensity observed in basic solutions.


Supplier: Anaspec Inc
Description: RKRSRAE is a selective substrate for protein kinase G (PKG) with a strong preference for PKG Iα (Km = 59 µM) over PKG II (Km = 305 µM).
Sequence:RKRSRAE
MW:902 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-418)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled TAT peptide, Abs/Em = 494/521 nm.
Sequence: FAM-YGRKKRRQRRR
MW: 1918.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103010-170)
Supplier: Anaspec Inc
Description: Central to the execution phase of apoptosis are the two closely related caspase-3 and caspase-7


Catalog Number: (103008-148)
Supplier: Anaspec Inc
Description: This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.
Sequence: YGRKKRRQRRRAKEGANVAG
MW: 2357.7 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103011-176)
Supplier: Anaspec Inc
Description: Excitation-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration


Catalog Number: (102996-408)
Supplier: Anaspec Inc
Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
529 - 544 of 1,910
no targeter for Bottom