You Searched For: Hytest Ltd

Catalog Number: (103007-324)

Supplier: Anaspec Inc

Description: This is a PUMA (p53 upregulated modulator of apoptosis) BH3 domain peptide. PUMA together with Bcl-xL, and cytoplasmic p53 coordinate p53 functions. PUMA proteins bind Bcl-2, localize to the mitochondria, and induce cytochrome C release and apoptosis in response to p53. PUMA may be a direct mediator of p53-induced apoptosis.
Sequence:EEQWAREIGAQLRRMADDLNAQYER
MW:3049.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-262)

Supplier: Anaspec Inc

Description: This peptide is a HLA-DRB 0101-restricted epitope from Influenza hemagglutinin (307-319).
Sequence:PKYVKQNTLKLAT
MW:1503.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103009-734)

Supplier: Anaspec Inc

Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (244-274) is a 31-amino acid long peptide derived from the Repeat 1 domain.
Sequence:Ac-QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK
MW:3299.83 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This is fluorescent GLP-1 labeled at the peptide C-terminus with FAM, Abs/Em=494/521 nm. In response to Glucose ingestion, proglucagon in the intestinal L cells is cleaved into GLP-1 (1-36). Prior to secretion into the circulation, GLP-1 (1-36) is further processed into amidated GLP-1 (7-36)-and small amounts of glycine-extended GLP-1 (7-37). Both GLP-1 (7-36) and GLP-1 (7-37), causes glucose dependent release of insulin by pancreatic beta-cells. They also play a role in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 peptides such as GLP-1 (1-36) have been used to investigate restoration of pancreatic beta cell function. GLP-1 is also produced in the central nervous system.
Sequence: FAM-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
MW: 4469.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103006-116)

Supplier: Anaspec Inc

Description: Des-octanoyl (or Des-acyl) Ghrelin is the unacylated precursor peptide to Ghrelin. Des-octanoyl Ghrelin is converted to Ghrelin by the enzymic addition of an octanyl group. Studies indicate that the amount of Des-octanoyl Ghrelin in the circulation is approximately 20 fold higher than that of Ghrelin. Des-octanoyl Ghrelin is not an agonist of the Ghrelin growth hormone receptor 1a (GHSR1a).
Sequence: GSSFLSPEHQKAQQRKESKKPPAKLQPR
MW: 3188.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103006-914)

Supplier: Anaspec Inc

Description: This sequence corresponds to the N-terminus of histone H3, spanning amino acids 1 to 25, amidated. Histones are small proteins (11–22 kDa) that mediate the folding of DNA into chromatin.
Sequence:ARTKQTARKSTGGKAPRKQLATKAA-NH2
MW:2625.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-222)

Supplier: Anaspec Inc

Description: LyP-1 recognizes lymphatics and tumor cells in certain tumors, but not lymphatics in normal tissues. Screening on breast carcinoma xenografts shows positive to cyclic 9-amino-acid peptide, LyP-1. The LyP-1 also recognizes an osteosarcoma xenograft, and spontaneous prostate and breast cancers in transgenic mice. LyP-1 peptide is detected in tumor structures that are positive for several lymphatic endothelial markers and negative for blood vessel markers. LyP-1 accumulates in the nuclei of the putative lymphatic cells, and in the nuclei of tumor cells.
Sequence:CGNKRTRGC (S-S Bonded)
MW:992.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-532)

Supplier: Anaspec Inc

Description: Cathepsin B is a member of the cathepsin family consisting of 12 cysteine proteases with broad exo- and endopeptidase activity

Sale

Supplier: Anaspec Inc

Description: This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4418 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-352)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 555 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates that are only slightly red-shifted compared to those of Cy™ 3 dyes, resulting in an optimal match to filters designed for CyTM dyes.

Sale

Catalog Number: (103010-816)

Supplier: Anaspec Inc

Description: ROX dyes have longer excitation and emission wavelengths than the other ‘conventional’ rhodamines. These dyes are used to label peptides, proteins, and other biological ligands. 5-ROX, 6-ROX and their mixture 5(6)-ROX are used to label biomolecules by EDC-mediated reactions.

Sale

Catalog Number: (103010-852)

Supplier: Anaspec Inc

Description: 6-TAMRA, SE is the other purified single isomer of 5(6)-TAMRA, SE. It is predominantly used for nucleotide labeling and DNA sequencing.

Sale

Catalog Number: (103009-404)

Supplier: Anaspec Inc

Description: This heparin-binding peptide is derived from vitronectin (367-378). Vitronectin is a glycoprotein found in monomer form in the blood and oligomer form in the extraceullular matrix. This peptide has been shown to promote the adhesion and undifferentiated growth of human pluripotent stem cells.
Sequence:GKKQRFRHRNRKG
MW:1668 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-798)

Supplier: Anaspec Inc

Description: Calpains are a family of intracellular Ca2+ dependent cysteine proteases. They respond to Ca2+ signals by cleaving many specific proteins, thereby irreversibly modifying their function(s). They are implicated in a variety of Ca2+ regulated cellular processes as well as various pathological phenomena, such as ischemic injury, muscular dystrophy, diabetes, cataract, atherosclerosis, Alzheimer’s disease, and cancer. Calpains represent potential therapeutic targets for drug discovery.
This 7-amino-4-methylcoumarin (AMC) labeled peptide is widely used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases. Cleavage of this AMC peptide by the enzymes generates strongly fluorescent AMC that is monitored fluorimetrically at Abs/Em=353/442 nm.
Sequence:Suc-LLVY-AMC
MW:763.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: Aß (12–28) residues are the binding site for apolipoprotein E (apoE) on Aß. This sequence encompasses a hydrophobic domain (residues 14–21) and a ß-turn (residues 22–28) which place two hydrophobic domains of Aß 14 to 21 and 29 to 40/42 opposite each other, allowing for the assembly of Aß peptides into fibrils. The secondary structure of Aß (12- 28), a neutral peptide, is dominated by a-helix and random coil.
equence: VHHQKLVFFAEDVGSNK
Molecular Weight: 1955.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-030)

Supplier: Anaspec Inc

Description: This peptide is a selective PAR4 antagonist which inhibits thrombin- and PAR-4 agonist induced rat platelet aggregation.
Sequence: trans - Cinnamoyl - YPGKF - NH2
MW: 739.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale