You Searched For: 600007

Description: The SensoLyte® 520 HIV Assay Kit uses a new FRET peptide substrate that incorporates HiLyte™ Fluor 488 (fluorophore) and QXL® 520 (quencher) for continuous measurement of enzyme activities. In the intact FRET peptide, the fluorescence of HiLyte™ Fluor 488 is quenched by QXL® 520. Upon cleavage of the FRET peptide by HIV protease, the fluorescence of HiLyte™ Fluor 488 is recovered and can be continuously monitored at excitation/emission = 490 nm/520 nm. With superior fluorescence quantum yield and longer emission wavelength, this HiLyte™ Fluor 488/QXL® 520-based FRET peptide shows less interference from autofluorescence of test compounds and cellular components, thus providing better assay sensitivity. The assays are performed in a convenient 96-well or 384-well microplate format.

Catalog Number: 103010-178

Supplier: Anaspec Inc

Sale

Description: Transportan is an amphipathic antimicrobial cell-penetrating peptide.
Sequence:GWTLNSAGYLLGKINLKALAALAKKIL
MW:2841.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-484

Supplier: Anaspec Inc

Sale

Description: Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
This Cholecystokinin (CCK) analog retains all the bioactivities of CCK8, but was found to be remarkably more stable in acidic media and unaffected by air oxidation due to Met replacements (Thr 28 and Nle31 were substituted for Methionine). The predominant conformation contains a gamma-turn centered on Thr4, separated by Gly5 from a helical segment that comprises the C-terminal residues.
Sequence: RD-Y(SO3H)-TGW-Nle-DF-NH2
MW: 1251.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102996-332

Supplier: Anaspec Inc

Sale

Description: VIP (1−12), vasoactive intestinal peptide fragment 1-12 with a mass of 1425.5 da, is mostly used as a standard in mass spectrometry
Sequence:HSDAVFTDNYTR
MW:1425.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103003-696

Supplier: Anaspec Inc

Sale

Description: Aggrecanases belong to the ADAMTS (A disintegrin and metalloprotease with thrombospondin motif) family of proteases. Aggrecanases cleave aggrecan, the major structural component of cartilage. Aggrecanase-1 (ADAMTS-4) is a major aggrecanase in human osteoarthritic cartilage.
This FRET peptide was used in an ADAMTS-4 (Aggrecanase-1) assay. Ex/Em = 340/420 nm.
Sequence:Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
MW:1644.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103005-926

Supplier: Anaspec Inc

Sale

Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4757.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 103003-714

Supplier: Anaspec Inc

Sale

Description: QXL® 670 dyes are optimized quenchers for Cy5 and Cy5-like fluorophores such as HiLyte™ Fluor 647.

Catalog Number: 103011-072

Supplier: Anaspec Inc

Sale

Description: This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
MW:4384.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102996-096

Supplier: Anaspec Inc

Sale

Description: Tetramethylrhodamine-5 C2 maleimide is a good alternative to tetramethylrhodamine-5-maleimide with excitation/emission wavelength at 544/572 nm. Its spectral characteristics are very close to those of tetramethylrhodamine-5-maleimide (+2 nm). It is 40% less expensive compared to tetramethylrhodamine-5-maleimide, and can be used for thiol modification of proteins, antibodies and peptides.

Catalog Number: 103011-006

Supplier: Anaspec Inc

Sale

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-10 (stromelysin 2) is involved in several pathological conditions, such as cancer, arthritis and wound healing. MMP-10 is secreted as zymogen with a prodomain, a catalytic domain, a hinge region, and a hemopexin-like domain. It can activate other MMPs such as MMP-1, MMP-8 and degrade a variety of substrates, including gelatin, collagens III, IV and V, fibronectin, aggrecan

This recombinant human MMP-10 was expressed as a pro-enzyme enzyme from its DNA sequence7 transfected into a mouse myeloma cell line, NS0. The apparent Mr on SDS-PAGE is 58-kDa. Incubation with 1 mM APMA at 37°C for 1-2 hours will activate pro-MMP-10. Its activity can be measured by FRET peptides

Catalog Number: 103010-388

Supplier: Anaspec Inc

Sale

Description: This peptide is histone H3 (44-63) with acetylation at Lys56. Lys56 acetylation occurs during premeiotic and mitotic S phases and persists through DNA damage repair and is catalyzed by the Rtt109-Vps75 histone acetyltransferase (HAT) complex. A deficiency of acetylated Lys56 in histone H3 is implicated in spontaneous chromosome breaks during mitosis, suggesting that this modification is important for replisome integrity and DNA replication.
Sequence:GTVALREIRRYQ-K(Ac)-STELLIR
MW:2444.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-034

Supplier: Anaspec Inc

Sale

Description: TAMRA is one of the most popular fluorophores used in various bioconjugations. 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.

Catalog Number: 103010-382

Supplier: Anaspec Inc

Sale

Description: This peptide, containing the consensus sequence XKYX(P/V)M, is found to stimulate phospholipase C (PLC)-mediated formation of InoPs in certain cell lines and human neutrophils. WKYMVm-NH2 may have the ability to activate the microbicidal functions of human neutrophils.
Sequence:WKYMVm-NH2
MW:856.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 102996-752

Supplier: Anaspec Inc

Sale

Description: This is a CGRP receptor antagonist.
Sequence:VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
MW:3125.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 102999-366

Supplier: Anaspec Inc

Sale

Description: Fluorescein isothiocyanate (FITC) remains one of the most popular fluorescent labeling reagents, probably due to the low cost of the material. 5-FITC and 6-FITC have very similar absorption and fluorescence spectra. However, the isomers may differ in their binding and reactivity to proteins, and the conjugates may elute under different chromatographic conditions or migrate differently in electrophoretic gels.

Catalog Number: 103010-374

Supplier: Anaspec Inc

Sale

Description: Oxytocin (OT) is a 9-amino acid peptide that is synthesized primarily in the hypothalamic neurons, specifically the magnocellular oxytocin neurons in the supraoptic and paraventricular nuclei and is secreted by the posterior pituitary gland. It is also secreted from other tissues, such as the ovaries and testes. Circulating OT is important during parturition and lactation. In the pregnant uterus, oxytocin and the oxytocin receptor play a major part for uterine contractility and the induction of labor. OT is also involved in complex social behaviors such as affiliation, sexual behavior, social recognition, stress buffering, aggression, and trust.
Sequence: CYIQNCPLG-NH2 (Disulfide bridge: 1-6)
MW: 1007.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102996-498

Supplier: Anaspec Inc

Sale