Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-102999-368

Human;Pig Endothelin 1

Supplier: Anaspec Inc
Description: ET-1 is a potent vasoconstrictor peptide derived from endothelial cells. It plays a role in regulation of cardiovascular functions
Sequence:CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2492 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-102996-332

Human [Thr28, Nle31]-Cholecystokinin (25-33), sulfated

Catalog Number: (102996-332)
Supplier: Anaspec Inc
Description: Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
This Cholecystokinin (CCK) analog retains all the bioactivities of CCK8, but was found to be remarkably more stable in acidic media and unaffected by air oxidation due to Met replacements (Thr 28 and Nle31 were substituted for Methionine). The predominant conformation contains a gamma-turn centered on Thr4, separated by Gly5 from a helical segment that comprises the C-terminal residues.
Sequence: RD-Y(SO3H)-TGW-Nle-DF-NH2
MW: 1251.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-102996-070

Magainin 2

Catalog Number: (102996-070)
Supplier: Anaspec Inc
Description: Magainin 2 assumes an amphiphilic helix when bound to acidic phospholipids, forming a pore composed of a dynamic, peptide-lipid supramolecular complex.
Sequence:GIGKFLHSAKKFGKAFVGEIMNS
MW:2466.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-020

[Lys(Me3)4]-Histone H3 (1-10)

Catalog Number: (103008-020)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-4.
Sequence:ART-K(Me3)-QTARKS
MW:1188.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-034

[Lys(Ac)56]-Histone H3 (44-63)

Catalog Number: (103009-034)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (44-63) with acetylation at Lys56. Lys56 acetylation occurs during premeiotic and mitotic S phases and persists through DNA damage repair and is catalyzed by the Rtt109-Vps75 histone acetyltransferase (HAT) complex. A deficiency of acetylated Lys56 in histone H3 is implicated in spontaneous chromosome breaks during mitosis, suggesting that this modification is important for replisome integrity and DNA replication.
Sequence:GTVALREIRRYQ-K(Ac)-STELLIR
MW:2444.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-752

W Peptide

Catalog Number: (102996-752)
Supplier: Anaspec Inc
Description: This peptide, containing the consensus sequence XKYX(P/V)M, is found to stimulate phospholipase C (PLC)-mediated formation of InoPs in certain cell lines and human neutrophils. WKYMVm-NH2 may have the ability to activate the microbicidal functions of human neutrophils.
Sequence:WKYMVm-NH2
MW:856.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-478

Rana Temporaria Temporin L

Catalog Number: (103008-478)
Supplier: Anaspec Inc
Description: Temporin L is a hydrophobic peptide amide derived from the frog Rana temporaria. This peptide penetrates the hydrophobic core of the cell membrane to penetrate and disrupt the lipid bilayer. Temporin L enhances Temporin A and Temporin B activity by preventing their oligomerization to Lipopolysaccharide (LPS), allowing them to bypass LPS and access the cytoplasmic membrane. This peptide is active against Gram-positive and Gram-negative bacteria, including B. megaterium and E. coli.
Sequence:FVQWFSKFLGRIL-NH2
MW:1640 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-546

SensoLyte® 520 Cathepsin K Assay Kit Fluorimetric, AnaSpec, Inc.

Catalog Number: (103010-546)
Supplier: Anaspec Inc
Description: Cathepsin K is the lysosomal cysteine protease involved in bone remodeling and resorption, also having a potential as a drug target in autoimmune diseases and osteoporosis
Image Unavailable-102999-788

Human Beta-Amyloid (1-38)

Supplier: Anaspec Inc
Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Image Unavailable-103008-232

Interphotoreceptor Retinoid Binding Protein Fragment Peptide

Catalog Number: (103008-232)
Supplier: Anaspec Inc
Description: R16 is an IRBP (Interphotoreceptor retinoid binding protein) derived peptide. Photoreceptor cell protein is capable of inducing an experimental autoimmune uveitis (EAU) in susceptible animal strains.
Sequence:ADGSSWEGVGVVPDV
MW:1473.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-382

AnaTag™ 5 - TAMRA Protein Labeling Kit *Ultra Convenient*, Anaspec

Catalog Number: (103010-382)
Supplier: Anaspec Inc
Description: TAMRA is one of the most popular fluorophores used in various bioconjugations. 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.
Image Unavailable-102996-468

Human Thrombin Receptor Activator for Peptide 6

Supplier: Anaspec Inc
Description: This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-103006-484

Transportan

Catalog Number: (103006-484)
Supplier: Anaspec Inc
Description: Transportan is an amphipathic antimicrobial cell-penetrating peptide.
Sequence:GWTLNSAGYLLGKINLKALAALAKKIL
MW:2841.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102999-772

Human;Rat Biotin-Corticotropin Releasing Factor, Biotin-CRF,Biotin

Catalog Number: (102999-772)
Supplier: Anaspec Inc
Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: Biotin-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4984.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-102996-096

Pig Big Endothelin 1 (1-39)

Catalog Number: (102996-096)
Supplier: Anaspec Inc
Description: This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS (Disulfide bridge: 1-15 and 3-11)
MW:4384.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103003-696

Human;Pig;Rat Viasoactive intestinal peptide (1-12)

Catalog Number: (103003-696)
Supplier: Anaspec Inc
Description: VIP (1−12), vasoactive intestinal peptide fragment 1-12 with a mass of 1425.5 da, is mostly used as a standard in mass spectrometry
Sequence:HSDAVFTDNYTR
MW:1425.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
353 - 368 of 1,910
no targeter for Bottom