You Searched For: Hytest Ltd

Catalog Number: (103007-114)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
MW: 4442.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103006-560)

Supplier: Anaspec Inc

Description: This peptide is a rat homologue of the human cathelicidin LL-37. Rat cathelicidin-related antimicrobial peptide (rCRAMP) was identified in granulocytes, thymus, testis, lung, mouth mucosa, tongue, oesophagus, colon, caecum and small intestine. The rCRAMP peptide is present in specific CNS regions and may play a role in the innate immunity of the CNS. rCRAMP exhibits pro-healing activity in stomach.
Sequence:GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
MW:3946.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-200)

Supplier: Anaspec Inc

Description: This fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). Targeting this gamma- fibrinogen epitope could represent a potential therapeutic strategy for MS and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation.
Sequence:YSMKETTMKIIPFNRLSIG
MW:2229.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103007-474)

Supplier: Anaspec Inc

Description: This peptide is amino acids 154 to 186 fragment of secretogranin II, designated secretoneurin. Secretoneurin is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II. Secretoneurin acts as direct angiogenic cytokine, inhibits endothelial cell (EC) apoptosis, stimulates EC proliferation, and activates the mitogen-activated protein kinase (MAPK) system and the Akt pathway.
Sequence:TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
MW:3652 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-198)

Supplier: Anaspec Inc

Description: This peptide is derived from the tumor suppressor p53 mutant with the acetylated Lys on the side chain.
Sequence:KKGQSTSRHK-K(Ac)-LMFKTEG
MW:2133.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: Osteocalcin (OC) is a 49 amino acid peptide found exclusively in bone tissue and is highly conserved among species. It is a vitamin K- and D-dependent protein produced by osteoblasts, osteocytes and odontoblasts. It is deposited in extracellular bone matrix and is found in the serum. Serum osteocalcin, hydrolysed in the kidney and liver, is considered a specific marker of osteoblast activity and bone formation rate. It may be involved in regulation of osteoblast function, regulation of bone turnover and/or mineralization.
Sequence: YLYQWLGAPVPYPDPL-Gla-PRR-Gla-VC-Gla-LNPDCDELADHIGFQEAYRRFYGPV (Gla=γ-Carboxyglutamic Acid; Disulfide bridge: 23-29)
MW: 5929.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103006-238)

Supplier: Anaspec Inc

Description: Indolicidin, a member of the cathelicidin protein family, is a 13-residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. Indolicidin is microbicidal in-vitro against gram-positive and gram-negative bacteria, fungi, protozoa, and human immunodeficiency virus (HIV-1).
Sequence:ILPWKWPWWPWRR-NH2
MW:1906.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-276)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMP’s) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-1 (collagenase-1) is involved in tumor development and metastasis and rheumatoid arthritis. It is proposed as a therapeutic target for these diseases. Native pro-MMP-1 is prepared from culture medium of human rheumatoid synovial fibroblasts. MMP-1 is secreted as pro-enzyme, which consists of a propeptide of 80 amino acids, a catalytic domain of 162 amino acids, a 16-residue linker region, and a hemopexin domain of 189 amino acids. The native pro-MMP-1 has a major Mr 52-kDa unglycosylated and a minor Mr 57-kDa glycosylated form. The proteolytic activation of the 57/52-kDa species will form 47/42-kDa active collagenase, and a 22-kDa C-terminal fragment
The apparent Mr on SDS-PAGE is approximately 56kDa/52 kDa. The pro-MMP-1 can be fully activated by incubating with 1 mM APMA at 37°C for 3 hr. Its activity can be measured by FRET peptides. 10-20 ng of enzyme is sufficient for FRET-based assay

Sale

Catalog Number: (103007-148)

Supplier: Anaspec Inc

Description: This is the membrane-permeable postsynaptic density (PSD)-95-binding (decoy) peptide Tat-NR2Bct. It can transduce into neurons in cell culture.
Sequence: YGRKKRRQRRRKLSSIESDV
MW: 2518.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: This peptide, a PYY (3-36), a Y2R agonist, is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal and can inhibit food intake.
Sequence:IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4049.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102998-094)

Supplier: Anaspec Inc

Description: This kit is optimized to detect anti-rat MOG (1-125) IgG. Wells are pre-coated with recombinant rat MOG (1-125) protein and pre-blocked with BSA. The amount of anti-rat MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Ample materials and reagents are provided to perform 96 assays.

Sale

Catalog Number: (103008-566)

Supplier: Anaspec Inc

Description: This is a peptide substrate that is phosphorylated by Serine/Threonine kinase 11 (STK11), also known as LKB1. LKBtide is derived from sucrose non-fermenting 1 (SNF1) protein kinase, which is normally activated by the LKB1/AMP-activated protein kinase (AMPK) signaling pathway.
Sequence:LSNLYHQGKFLQTFCGSPLYRRR
MW:2785.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-464)

Supplier: Anaspec Inc

Description: This peptide is derived from tyrosinase-related protein 2 (TRP2) residues 181-188, and has been identified as the primary epitope of TRP2 recognized by anti-B16 melanoma cytotoxic T lymphocytes (CTLs).
Sequence:VYDFFVWL
MW:1088.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-202)

Supplier: Anaspec Inc

Description: This is a scrambled sequence of the g-fibrinogen amino acids 377 to 395. The original fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). This scrambled peptide fails to produce these functions.
Sequence:KMMISYTFPIERTGLISNK
MW:2229.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103007-176)

Supplier: Anaspec Inc

Description: This is a fragment of human intestinal growth factor glucagon-like peptide 2, GLP2, containing amino acids 146 to 178. It is an intestinotrophic growth hormone that promotes many aspects of intestinal function, including enhancement of mucosal growth and promotion of nutrient absorption. GLP-2 is a hormone that can rapidly improve intestinal epithelial barrier function.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITD
MW: 3766.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (102999-026)

Supplier: Anaspec Inc

Description: This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors.
Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
MW: 4504.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale