Human Beta-Amyloid (1-38)

Supplier: Hytest Ltd
Ratings: (No Reviews)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

AS-24233 AS-24234
102996-490EA 309.85 USD
102996-490 102999-788
Human Beta-Amyloid (1-38)
Proteins and Peptides

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR