Print…

You Searched For: BELEX


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103010-600

SensoLyte® Rh110 DPPIV Assay Kit (Fluorimetric), AnaSpec Inc.

Catalog Number: (103010-600)
Supplier: Anaspec Inc
Description: DPPIV is a widely distributed serine protease that cleaves two amino acids from small peptides containing alanine or proline in the second position of the N-terminus of the peptide
Image Unavailable-103009-512

Tau peptide,Biotin

Catalog Number: (103009-512)
Supplier: Anaspec Inc
Description: The microtubule-associated protein Tau, whose hyperphosphorylated form is associated to the Alzheimer's disease, is also known to be post-translationally modified by the addition of N-acetyl-D-glucosamine to some Ser or Thr. The Ser-400 tau O-GlcNAc modification was detected in rat brain.
Sequence:KWKHGAEIVYKSPVV-S(OGlcNAc)-GDTSPRHLSNVK-K(biotin)-NH2
MW:3677.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-046

[Lys(Ac)12]-Histone H4 (1-25)-GSGSK,Biotin

Catalog Number: (103009-046)
Supplier: Anaspec Inc
Description: This peptide is histone H4 (1-25) with acetylation at Lys12. It is biotinylated through a C-terminal GSGSK linker. Lys12 acetylation is necessary for the methylation of Lys9 of histone H3 in the formation of heterochromatin. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLG-K(Ac)-GGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-086

Human Parathyroid Hormone (1-34), Biotinylated, Biotin

Catalog Number: (102996-086)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4344.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103006-426

HIV TAT Cys(Npys)

Catalog Number: (103006-426)
Supplier: Anaspec Inc
Description: This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: C(Npys)YGRKKRRQRRR-NH2
MW: 1816.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103008-192

Human Beta-Amyloid (1-13)

Catalog Number: (103008-192)
Supplier: Anaspec Inc
Description: This peptide is beta-Amyloid (1-13), human sequence.
Sequence: DAEFRHDSGYEVH
Molecular Weight: 1561.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-180

Beta-Amyloid A4 Protein Precursor (740-770)

Catalog Number: (103007-180)
Supplier: Anaspec Inc
Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-420

SensoLyte® 520 Cathepsin S Assay Kit Fluorimetric, AnaSpec, Inc.

Catalog Number: (103010-420)
Supplier: Anaspec Inc
Description: Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases
Image Unavailable-103008-536

[Lys(Ac)16]-Histone H4 (1-21)-GGK,Biotin

Catalog Number: (103008-536)
Supplier: Anaspec Inc
Description: This peptide is histone H4 amino acids 1 to 16, acetylated at Lys-16 and at the N-terminus. This peptide also contains a GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103011-414

HiLyte™ Fluor 532 hydrazide fluorescent dye

Catalog Number: (103011-414)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 532 hydrazide is a carbonyl-reactive fluorescent labeling dye.
Image Unavailable-103007-104

Human Beta-Amyloid (1-17)

Catalog Number: (103007-104)
Supplier: Anaspec Inc
Description: This is beta-Amyloid peptide fragment derived from amino acids 1 to 17. This peptide was employed in the b-Amyloid solubility studies.
Sequence: DAEFRHDSGYEVHHQKL
Molecular Weight: 2068.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103011-020

5-FAM cadaverine

Catalog Number: (103011-020)
Supplier: Anaspec Inc
Description: 5-FAM cadaverine is an excellent building block to prepare fluorescent ligands for receptor binding assays. Additionally, we have proven that the fluorescein cadaverine derivative is also a good transglutaminase substrate for site-specific protein labeling like FITC cadaverine.
Image Unavailable-103008-322

[Lys(Me2)18]-Histone H3 (1-21)-GGK,Biotin

Catalog Number: (103008-322)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1-21. It is dimethylated at lysine 18 with a C-terminal GG linker followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2
MW:2750.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-980

Erktide

Catalog Number: (103006-980)
Supplier: Anaspec Inc
Description: Erktide is a peptide substrate for ERK2 (extracellular regulated protein kinase 2) whose activity is regulated by mitogenic stimuli.
Sequence:IPTTPITTTYFFFK
MW:1677 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103011-356

Pentoxyresorufin

Catalog Number: (103011-356)
Supplier: Anaspec Inc
Description: Fluorogenic cytochrome P-450 substrate that generates red fluorescent product upon enzyme cleavage
Image Unavailable-103007-790

P70 S6 Kinase Substrate

Catalog Number: (103007-790)
Supplier: Anaspec Inc
Description: This peptide is a substrate for p70 ribosomal S6 kinase.
Sequence:KKRNRTLTV
MW:1115.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-79 - -64 of 1,910
no targeter for Bottom