Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103007-334

Beta-Amyloid (1-40) Binding Peptide,Biotin

Catalog Number: (103007-334)
Supplier: Anaspec Inc
Description: This 20 amino acid peptide binds to the amyloid form of beta-Amyloid (1-40) but not to monomeric beta-Amyloid (1-40). This sequence represents new potential carrier molecules to deliver medicines to amyloid plaques in AD patients and to image plaques in AD brains. The ability to directly target reagents to the amyloid form of the beta-Amyloid peptide may allow the delivery of neuroprotective agents to make amyloid plaques less toxic, the delivery of amyloid-destroying molecules to eliminate plaques, or the delivery of reagents to prevent amyloid plaque formation. This sequence is biotinylated on the N-terminus.
Sequence: Biotin-DWGKGGRWRLWPGASGKTEA
Molecular Weight: 2441.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103003-136

CREBtide, FAM (Carboxyfluorescein)

Supplier: Anaspec Inc
Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:5-FAM-KRREILSRRPSYR
MW:2075.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103006-426

HIV TAT Cys(Npys)

Catalog Number: (103006-426)
Supplier: Anaspec Inc
Description: This peptide corresponds to the protein transduction domain of the TAT protein and is synthesized with an activated cysteine residue C(Npys), wherein Npys is 3-Nitro-2-pyridinesulfenyl group and is used for activating S of cysteine and for rapid reaction when a thiol group is introduced. This kind of modification has been used to render this peptide as a cell penetrating and carrier peptide applicable in conjugation studies.
Sequence: C(Npys)YGRKKRRQRRR-NH2
MW: 1816.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103008-192

Human Beta-Amyloid (1-13)

Catalog Number: (103008-192)
Supplier: Anaspec Inc
Description: This peptide is beta-Amyloid (1-13), human sequence.
Sequence: DAEFRHDSGYEVH
Molecular Weight: 1561.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-180

Beta-Amyloid A4 Protein Precursor (740-770)

Catalog Number: (103007-180)
Supplier: Anaspec Inc
Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-420

SensoLyte® 520 Cathepsin S Assay Kit Fluorimetric, AnaSpec, Inc.

Catalog Number: (103010-420)
Supplier: Anaspec Inc
Description: Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases
Image Unavailable-103008-536

[Lys(Ac)16]-Histone H4 (1-21)-GGK,Biotin

Catalog Number: (103008-536)
Supplier: Anaspec Inc
Description: This peptide is histone H4 amino acids 1 to 16, acetylated at Lys-16 and at the N-terminus. This peptide also contains a GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-408

Cys(Npys)-(Arg)9

Catalog Number: (103006-408)
Supplier: Anaspec Inc
Description: (Arg)9 is a cell-permeable peptide used for drug delivery. It can traverse the plasma membrane of eukaryotic cells, and can be easily conjugated to the molecule to be internalized
Sequence:C(Npys)RRRRRRRRR-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-616

[Arg(Me2a)8]-Histone H3(1-21)-K,Biotin

Catalog Number: (103008-616)
Supplier: Anaspec Inc
Description: This peptide is histone H3 amino acid residues 1 to 21. It is asymmetrically dimethylated at arginine 8 with both methyl groups added to one nitrogen of the guanidinium group, and contains a C-terminal biotinylated lysine.
Sequence:ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2
MW:2636.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-268

Syntide-2

Catalog Number: (102996-268)
Supplier: Anaspec Inc
Description: The native peptide, PLARTLSVAGLPGKK (cat# 22511), is a selective substrate for CaM kinase II and protein kinase C. It is a poor substrate for phosphorylase kinase and is not phosphorylated by myosin light chain kinase. The sequence of PLARTLSVAGLPGKK is homologous to phosphorylation site 2 in glycogen synthase. The relative Vmax/Km ratios of the peptide for different kinases are 100 for CaMK II, 22 for protein kinase C, 2 for phosphorylase kinase, and 0.5 for myosin light chain kinase respectively.
Sequence:PLARTLSVAGLPGKK
MW:1507.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102996-804

Human Endothelin 1, FAM (Carboxyfluorescein)

Catalog Number: (102996-804)
Supplier: Anaspec Inc
Description: This is a fluorescent (FAM)-labeled Endothelin 1 peptide, Abs/Em = 494/521 nm.
Sequence:FAM-CSCSSLMDKECVYFCHLDIIW (Disulfide bridge: 1-15 and 3-11)
MW:2850.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103007-104

Human Beta-Amyloid (1-17)

Catalog Number: (103007-104)
Supplier: Anaspec Inc
Description: This is beta-Amyloid peptide fragment derived from amino acids 1 to 17. This peptide was employed in the b-Amyloid solubility studies.
Sequence: DAEFRHDSGYEVHHQKL
Molecular Weight: 2068.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-804

Gila Fluorescein-Trp25-Exendin-4 (FLEX), Fluorescein

Catalog Number: (103007-804)
Supplier: Anaspec Inc
Description: This peptide is Exendin-4 labeled with fluorescein at the Tryptophan residue. FLEX is equipotent to GLP-1(7-36)-amide and exendin-4 as an inhibitor of [125I] GLP-1 binding to the human GLP-1 receptor stably expressed in CHO cells, and maintains full biological potency and efficacy as measured by the stimulation of cAMP accumulation in these cells. FLEX binding to CHO/hGLP-1R membranes results in an increase in fluorescence anisotropy. The binding is specific and saturable (Kd = 2.0 +/- 0.4 nM), and GLP-1(7-36)-amide and Exendin-4 are equipotent inhibitors of FLEX binding to the human GLP-1 receptor. Thus, FLEX is a potent, biologically active ligand that is useful for the study of the binding and functional characteristics of the human GLP-1 receptor.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2
MW: 4606.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103011-020

5-FAM cadaverine

Catalog Number: (103011-020)
Supplier: Anaspec Inc
Description: 5-FAM cadaverine is an excellent building block to prepare fluorescent ligands for receptor binding assays. Additionally, we have proven that the fluorescein cadaverine derivative is also a good transglutaminase substrate for site-specific protein labeling like FITC cadaverine.
Image Unavailable-103011-004

Tetramethylrhodamine-6 C2 maleimide

Catalog Number: (103011-004)
Supplier: Anaspec Inc
Description: Tetramethylrhodamine-6 C2 maleimide is a good alternative to tetramethylrhodamine-6-maleimide with excitation/emission wavelength at 544/572 nm. Its spectral characteristics are very close to those of tetramethylrhodamine-6-maleimide (+2 nm). It is 40% less expensive compared to tetramethylrhodamine-6-maleimide, and can be used for thiol modification of proteins, antibodies and peptides.
Image Unavailable-102996-412

Human;Sheep;Rat PACAP (1-38)-Lys(Biotin), amide, Biotin

Catalog Number: (102996-412)
Supplier: Anaspec Inc
Description: This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
401 - 416 of 1,910
no targeter for Bottom