You Searched For: Hytest Ltd

Catalog Number: (103010-932)

Supplier: Anaspec Inc

Description: Spectra of HiLyte™ Fluor 555 conjugates are slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.

Sale

Catalog Number: (103009-086)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-25) with acetylation at Lys12 and Lys16 and trimethylation at Lys20, followed by a C-terminal GSGS linker and a biotinylated Lys. Trimethylation at Lys20 of histone H4 is catalyzed by Suv4-20 and is involved in transcriptional silencing and heterochromatin formation in eukaryotes. It has been shown that histone H4 is preferentially acetylated first at Lys16, then at Lys12. Diacetylated histone H4 has been shown to bind repressor protein TUP1. Acetylation of histone H4 also regulates heterochromatin formation by promoting the binding of bromodomains to p300 and transcription factor TAFII250 and inhibiting interactions with SIR3. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHR-K(Me3)-VLRDN-GSGSK(Biotin)
MW:3358.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-232)

Supplier: Anaspec Inc

Description: Beta-Casomorphin-7 is a milk opioid peptide derived from fragment 60-66 of bovine beta-Casein. It strongly stimulates mucin secretion in the rat jejunum through a nervous pathway and mu-opioid receptor activation. The presence of the Tyr-Pro aromatic sequence makes the peptide selective for the mu receptor while the high contents of proline residues in the sequence makes the peptide resistant to degradation by gastrointestinal enzymes.
Sequence: YPFPGPI
MW: 789.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (103006-878)

Supplier: Anaspec Inc

Description: This peptide, derived from the BH3 domain of Bak (Flu-BakBH3), has been shown to have high-affinity binding to a surface pocket of the Bcl-XL protein that is essential for its death antagonist function.
Sequence:GQVGRQLAIIGDDINR
MW:1724.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-098)

Supplier: Anaspec Inc

Description: This hybrid peptide named colivelin was synthesized to potentiate the neuroprotective effect of humanin (HN). Colivelin is composed of Activity-Dependent Neurotrophic Factor (ADNF) C-terminally fused to AGA-(C8R) HNG17, a potent HN derivative. Colivelin completely suppresses cell death induced by overexpressed Familial Alzheimer's disease (FAD)-causative genes and beta-amyloid (1-43). Intraperitoneally administered colivelin suppresses memory impairment and might serve as a novel drug candidate for treatment of Alzheimer's disease.
Sequence:SALLRSIPAPAGASRLLLLTGEIDLP
MW:2645.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103011-142)

Supplier: Anaspec Inc

Description: Cell-permeant DNA minor groove binding dye

Sale

Catalog Number: (103007-396)

Supplier: Anaspec Inc

Description: This sequence is amino acids 1 to 21 fragment of the histone 4, acetylated at the N-terminus and biotinylated on the side chain of Lys. A GG spacer has been added on the C-terminus of Lys.
Sequence:Ac-SGRGKGGKGLGKGGAKRHRKV-GGK(Biotin)
MW:2602.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-670)

Supplier: Anaspec Inc

Description: This b-amyloid (1-42) contains the Flemish (D23N) mutation where Asp23 is replaced by Asn.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: This 20-residue peptide, a major pathogenic T-cell epitope (161–180), is present in the first homologous repeat of the interphotoreceptor retinoid binding protein peptide (IRBP). It has been shown to induce posterior uveitis (EAU).
Sequence:SGIPYIISYLHPGNTILHVD
MW:2209.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-538)

Supplier: Anaspec Inc

Description: This amino acids 11 to 22 fragment of b-amyloid is capable of forming well-organized amyloid fibrils in vitro, similar to the pathogenic ones found in amyloidosis. Analysis of the structural properties of one monomer of b-amyloid (11-22) as well as of the aggregation mechanisms for four chains of b-amyloid (11-22) showed that the system assembles rapidly into a random globular state that evolves into three- and four-stranded antiparallel beta-sheets. The aggregation process is considerably accelerated by the presence of preformed dimers.
Sequence: EVHHQKLVFFAEDVG
Molecular Weight: 1755 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103008-678)

Supplier: Anaspec Inc

Description: This is an amidated peptide derived from residues 361-393 of human p53 tumor suppressor protein with acetylation at Lys382. This peptide is biotin-labeled at its N-terminus with a 6-carbon LC linker. Activated p53 functions to induce cell cycle arrest and apoptosis in response to signals such as DNA damage. Acetylation of p53 reduces ubiquitination by MDM2 and increases p53 half-life in vivo.
Sequence:Biotin-LC-GSRAHSSHLKSKKGQSTSRHK-K(Ac)-LMFKTEGPDSD-NH2
MW:4034.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-552)

Supplier: Anaspec Inc

Description: The renin–angiotensin system (RAS) plays a central role in the regulation of blood pressure and electrolyte homoeostasis. An overactive renin-angiotensin system leads to hypertension. As a result, renin is an attractive target for the treatment of this disease

Recombinant mouse prorenin is produced in HEK cells and purified by chelated metal affinity chromatography. It contains an 8x-Histidine tag at the C terminus. The apparent Mr of recombinant enzyme on SDS-PAGE is 41.7 kDa. Prorenin, the precursor of renin, is a glycosylated aspartic protease that consists of 2 homologous lobes. Prorenin can be activated with trypsin. Its activity can be measured in a FRET-based enzymatic assay

Sale

Catalog Number: (103010-278)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-2 (72-kDa gelatinase-A) is involved in tumor development and metastasis. It is proposed as a therapeutic target for cancer.

Recombinant human MMP-2 was expressed as a pro-enzyme from its DNA sequence, transfected into CHO cells. The pro-MMP-2 can be fully activated by incubating with 1 mM APMA at 37°C for 20 min to 1 hr.Its activity can be measured in FRET-based enzymatic assays. 10-20 ng of enzyme is sufficient for FRET-based assay.

Sale

Catalog Number: (103003-288)

Supplier: Anaspec Inc

Description: More polar than biotin; used for cell tracing

Sale

Catalog Number: (103007-752)

Supplier: Anaspec Inc

Description: This peptide is amino acid residue 149 to 157 of chemerin, a natural ligand of ChemR23, a G protein-coupled receptor expressed in immature dendritic cells and macrophages. This peptide retains most of the activities of the full size protein including ligand binding to chemerin receptor. It is a chemoattractant factor for human immature dendritic cells (DCs), macrophages, and NK cells, and play a role in skin inflammatory processes.
Sequence:YFPGQFAFS
MW:1063.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103003-300)

Supplier: Anaspec Inc

Description: Building block for modifying carboxy and carbonyl groups; substrate for transglutaminase

Sale