You Searched For: Hytest Ltd

Catalog Number: (103008-246)

Supplier: Anaspec Inc

Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103010-652)

Supplier: Anaspec Inc

Description: The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography. GST tag was not removed. The molecular weight of the recombinant GST-DJ-1protein is 47.3 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Sale

Catalog Number: (103010-650)

Supplier: Anaspec Inc

Description: The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography followed by GST tag cleavage and removal. The molecular weight of the recombinant DJ-1 protein is 19.9 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Sale

Supplier: Anaspec Inc

Description: The sequence (Accession # NP_003076)) corresponds to the human β-synuclein along with a 6x His tag expressed in E. coli. This human β-synuclein recombinant protein is offered at a low endotoxin level of <0.1 EU per μg protein.
Beta-synuclein belongs to the family of highly conservative proteins in vertebrates. N-terminal of β-synuclein is highly homologous to α-, γ-synucleins and consists of degenerative “KTKEGV” repeats. Similar to α-synuclein, beta-synuclein is found primarily in the brain; however, it does not associate with Lewy bodies in Parkinson disease like α-synuclein. Beta-synuclein was found to inhibit production of phosphatidic acid by the phospholipase D2 transmembrane protein in vitro. In addition, beta-synuclein was detected in many breast and ovarian tumors. Recent investigations demonstrated that beta-synuclein can induce mild experimental autoimmune encephalomyelitis (EAE) in Lewis rats.
The human β-synuclein recombinant proteins from AnaSpec are offered with low endotoxin levels of <1 EU per μg protein.

Supplier: Anaspec Inc

Description: This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (102997-814)

Supplier: Anaspec Inc

Description: MOG peptide fragment (35-55) induces autoantibody production and relapsing-remitting neurological disease causing extensive plaque-like demyelination

Sale

Catalog Number: (103003-370)

Supplier: Anaspec Inc

Description: Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.
Sequence:ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
MW:3442.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-976)

Supplier: Anaspec Inc

Description: Matriptase (also known as MT-SP1, ST14, TADG-15 and epithin) is a trypsin-like protease from the family of type II transmembrane serine proteases

Sale

Catalog Number: (103011-172)

Supplier: Anaspec Inc

Description: Excitation-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration

Sale

Supplier: Anaspec Inc

Description: This is the most characterized fragment of the HIV transactivator protein (TAT). This arginine-rich TAT peptide penetrates plasma membrane directly, but not through endocytosis.
Sequence: YGRKKRRQRRR
MW: 1559.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103003-258)

Supplier: Anaspec Inc

Description: Melan-A is a melanocyte differentiation antigen recognized by cytotoxic T lymphocytes. This sequence is a naturally presented Melan-A/MART-1 nonamer peptide. The Melan-A/MART-1 gene is expressed by normal melanocytes, as well as by most fresh melanoma samples and melanoma cell lines. This peptide appears to be a very common immunogenic epitope for HLA-A2-restricted melanoma-specific tumor-infiltrating lymphocytes (TIL) and may be useful for the development of immunotherapeutic strategies.
Sequence:AAGIGILTV
MW:814.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103003-304)

Supplier: Anaspec Inc

Description: Excellent reagent for detecting polyhistidine-containing biomolecules

Sale

Catalog Number: (103010-224)

Supplier: Anaspec Inc

Description: QXL® 490 dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores.

Sale

Catalog Number: (102996-064)

Supplier: Anaspec Inc

Description: Renin acts on this sequence serving as its substrate yielding Angiotensin I and VIHN. It has implications in cardiovascular system.
Sequence:DRVYIHPFHLVIHN
MW:1760 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103007-562)

Supplier: Anaspec Inc

Description: Big Endothelin-1 (1-38) is precursor of endothelin 1. Big endothelin-1 is cleaved to yield endothelin-1 via the activity of an endothelin-converting enzyme (ECE). Big Endothelin-1 can be hydrolyzed by chymase to generate endothelin 1 (1-21) in vitro. Endothelins are endothelium-derived vasoconstrictor peptides.
Sequence:CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11)
MW:4283 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale