Human Beta-Amyloid (40-1)

Supplier: Hytest Ltd
Ratings: (No Reviews)

Total Ratings: 0
Avg. Ratings: 0.0 out of 5

AS-22817 AS-22818
102999-344EA 369.77 USD
102999-344 102999-346
Human Beta-Amyloid (40-1)
Proteins and Peptides

This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR