You Searched For: Hytest Ltd

Catalog Number: (103003-296)

Supplier: Anaspec Inc

Description: Biotinylating reagent for carbohydrates and nucleic acids

Sale

Supplier: Anaspec Inc

Description: HiLyte™ Fluor594 acid, SE is an amine reactive reagent for labeling peptides, proteins and antibodies.

Catalog Number: (103007-440)

Supplier: Anaspec Inc

Description: This is 22 amino acids flagellin peptide known as flg2. It spans the core domain necessary for binding and biological activity in plant cells. This peptide spanning the 22 amino acids in the core of the conserved domain induces responses after treatment with fungal elicitors such as chitin fragments, xylanase, ergosterol, and high-mannose–type glycopeptides when applied in subnanomolar concentrations. Flagellin is the structural protein that forms the major portion of flagellar filaments. Flagellins from different bacterial species vary in their central part but show conservation of their N-terminal and C-terminal regions.
Sequence:QRLSTGSRINSAKDDAAGLQIA
MW:2272.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This human Angiotensin I (Ang I) sequence also corresponds to horse, sheep, pig, and rat Ang I. Ang I is cleaved to Ang II by the angiotensin-converting enzyme (ACE). There is also evidence for non-angiotensin-converting enzyme-dependent conversion of Ang I to Ang II. Human chymase efficiently converts the 10-mer Ang I to the 8-mer hormone Ang II by splitting the Phe8-His9 bond in Ang I.
Sequence: DRVYIHPFHL
MW: 1296.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103007-710)

Supplier: Anaspec Inc

Description: This peptide is a poly-gamma-D-glutamic acid (DPGA)10 construct that relates to the sequence of the Bacillus anthracis capsule which is composed of gamma DPGA. gamma DPGA is an essential virulence factor of B. anthracis. The capsule inhibits innate host defense through its antiphagocytic action. gamma DPGA is a poor immunogen, but when bound to a carrier protein, it elicits serum antibodies.

Sale

Catalog Number: (103008-434)

Supplier: Anaspec Inc

Description: This is a 5-FAM-labeled Smac/Diablo Peptide (Abs/Em=492/518 nm), which serves as a Livin inhibitor. Livin prevents apoptosis and sensitizes Livin-expressing cells to chemotherapy. This peptide has the potential to be used as a therapeutic agent in cancer treatment.
Sequence:AVPIAQKSEK-K(5-FAM)-NH2
MW:1555.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102996-408)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (102996-764)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a generic fluorogenic substrate for assaying MMPs. Abs/Em = 325/393 nm.
Sequence:Mca-PLGL-Dap(Dnp)-AR
MW:1094.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103003-178)

Supplier: Anaspec Inc

Description: This is a fluorescent (HiLyte™ Fluor 488)-labeled ß-Amyloid peptide, Abs/Em = 503/528 nm.

Sale

Catalog Number: (103006-558)

Supplier: Anaspec Inc

Description: This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
Sequence:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
MW:3878.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-652)

Supplier: Anaspec Inc

Description: The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography. GST tag was not removed. The molecular weight of the recombinant GST-DJ-1protein is 47.3 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Sale

Supplier: Anaspec Inc

Description: The sequence (Accession # NP_003076)) corresponds to the human β-synuclein along with a 6x His tag expressed in E. coli. This human β-synuclein recombinant protein is offered at a low endotoxin level of <0.1 EU per μg protein.
Beta-synuclein belongs to the family of highly conservative proteins in vertebrates. N-terminal of β-synuclein is highly homologous to α-, γ-synucleins and consists of degenerative “KTKEGV” repeats. Similar to α-synuclein, beta-synuclein is found primarily in the brain; however, it does not associate with Lewy bodies in Parkinson disease like α-synuclein. Beta-synuclein was found to inhibit production of phosphatidic acid by the phospholipase D2 transmembrane protein in vitro. In addition, beta-synuclein was detected in many breast and ovarian tumors. Recent investigations demonstrated that beta-synuclein can induce mild experimental autoimmune encephalomyelitis (EAE) in Lewis rats.
The human β-synuclein recombinant proteins from AnaSpec are offered with low endotoxin levels of <1 EU per μg protein.

Catalog Number: (103010-650)

Supplier: Anaspec Inc

Description: The sequence (Accession # NP_001116849) corresponding to the full length human DJ-1 protein along with N-terminal GST tag was expressed in E. coli. The recombinant DJ-1 protein was purified from bacterial lysate using GST affinity chromatography followed by GST tag cleavage and removal. The molecular weight of the recombinant DJ-1 protein is 19.9 kDa.
DJ-1 is also known as PARK7 (Parkinson disease protein 7). It is a 189-amino acid protein that is ubiquitously expressed in many organs including brain, liver, kidney, pancreas, heart, and others. Although DJ-1 was originally discovered as a novel oncogene product, it was found to play several other roles in biological processes. This includes the regulation of RNA binding activity, fertility, anti-oxidative stress, and is linked to the early onset of Parkinson disease when mutated. Sequence (Accession# NP_001116849) corresponds to the full length human DJ-1 protein and was expressed in E. coli.

Sale

Catalog Number: (102996-346)

Supplier: Anaspec Inc

Description: The intrastriatal perfusion with the neurotensin(1-13) [NT(1-13)] and its active fragment NT(8-13) on striatopallidal GABA leads to the increased striatal and pallidal GABA release, and this effect is antagonized by intrastriatal perfusion with the NT receptor antagonist. Neurotensin(8-13) is as potent as neurotensin but ineffective in [D-Tyr(11)]neurotensin. In the caudal nucleus accumbens, neurotensin(8-13) and neurotensin appears more potent than [D-Tyr(11)]neurotensin. In contrast, in the rostral nucleus accumbens, neurotensin(8-13) is less potent than [D-Tyr(11)]neurotensin and neurotensin.
Sequence:RRPYIL
MW:817 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103010-366)

Supplier: Anaspec Inc

Description: AMCA-X, SE is one of the most popular blue fluorescent tagging molecules. It is widely used to label antibodies, proteins and small drug molecules. AMCA-X succinimidyl ester contains a seven-atom aminohexanoyl spacer between the fluorophore and the reactive group.

Sale

Catalog Number: (103007-766)

Supplier: Anaspec Inc

Description: This is a peptide inhibitor of collagen fibrillar matrix assembly.
Sequence:SAGFDFSFLPQPPQEKAHDGGRYYRA
MW:2942.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale