Print…

You Searched For: BIO X CELL


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-102996-450

Plasminogen activator acrosine Substrate, AFC (Antibody-fluorophore conjugate)

Catalog Number: (102996-450)
Supplier: Anaspec Inc
Description: This is a fluorescent plasminogen activator acrosine substrate, Abs/Em=380/500.
Sequence:Z-GGR-AFC
MW:633.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-410

AMARA peptide

Catalog Number: (103007-410)
Supplier: Anaspec Inc
Description: AMARA peptide is a minimal substrate for several members of the protein kinases family. It contains the phosphorylation site for AMP-activated Protein Kinase (AMPK). AMARA peptide may be employed in the applications to measure AMPK-related kinase activity.
Sequence:AMARAASAAALARRR
MW:1542.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-190

CREBtide

Catalog Number: (103003-190)
Supplier: Anaspec Inc
Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:KRREILSRRPSYR
MW:1717 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-038

[Lys(Me2)36]-Histone H3 (31-41)

Catalog Number: (103008-038)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 31 to 41 di-methylated at Lys-36.
Sequence:STGGV-K(Me2)-KPHRY
MW:1257.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102998-084

SensoLyte® Anti-Human MOG (1-125) Mouse IgG Specific ELISA Kit, AnaSpec

Catalog Number: (102998-084)
Supplier: Anaspec Inc
Description: This kit is optimized to detect anti-human MOG (1-125) IgG in mouse serum or cerebrospinal fluid. Wells are pre-coated with recombinant human MOG (1-125) protein and pre-blocked with BSA. The amount of anti-human MOG IgG in serum or cerebrospinal fluid is quantified using ELISA. Mouse anti-human MOG IgG standard is included. Ample materials and reagents are provided to perform 96 assays in a 96-well plate format.
Image Unavailable-103007-864

Syk Kinase Peptide Substrate, Biotin

Catalog Number: (103007-864)
Supplier: Anaspec Inc
Description: This synthetic peptide is a biotinylated substrate for Syk kinase.
Sequence:Biotin-KEDPDYEWPSAK-NH2
MW:1689.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-936

HiLyte™ Fluor 555 amine fluorescent dye

Catalog Number: (103010-936)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 555 amine is a carbonyl-reactive fluorescent labeling dye that generates the conjugates that are only slightly red-shifted compared to those of Cy3 dye, resulting in an optimal match to filters designed for Cy3 dyes.
Image Unavailable-103010-906

Dansyl-X, SE [6-((5-Dimethylaminonaphthalene-1-Sulfonyl)amino) hexanoic acid, SE] ≥95% (by HPLC)

Catalog Number: (103010-906)
Supplier: Anaspec Inc
Description: Dansyl-X, SE, Synonym: Dansyl-X, NHS ester, amino-reactive building block used to prepare peptide conjugates and other bioconjugates, high efficient, Molecular Weight: 461.53, Spectral Properties: Abs/Em = 333/518 nm, Solvent System: DMF or DMSO, Storage -20 deg C, Size: 25 mg
Image Unavailable-103006-880

Human Peptide Myelin Oligodendrocyte Glycoprotein, AnaSpec

Catalog Number: (103006-880)
Supplier: Anaspec Inc
Description: This 11 mer peptide myelin oligodendrocyte glycoprotein ( pMOG) ( 44–54) represents the core binding epitope for MOG-specific CD8+ T cells. This is the minimal, functionally constant, length of the MOG (35–55) peptide that binds to CD8+ MOG-specific T cells and stimulates T cell proliferation in vitro.
Sequence: FSRVVHLYRNG
MW: 1347.6 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103006-512

Human PLP

Catalog Number: (103006-512)
Supplier: Anaspec Inc
Description: This is amino acid residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
Sequence: HCLGKWLGHPDKF
MW: 1537.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103010-356

AnaTag™ HiLyte™ Fluor 488 Microscale Protein Labeling Kit, Anaspec

Catalog Number: (103010-356)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488, SE is an excellent amine-reactive fluorescent labeling dye for generating protein conjugates. The spectrum of HiLyte™ Fluor488 is similar to fluorescein (FITC), resulting in an optimal match to filters designed for fluorescein.
Image Unavailable-103003-048

Mouse;Rat Amylin

Catalog Number: (103003-048)
Supplier: Anaspec Inc
Description: Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103007-832

Noxa BH3, Peptide 1

Catalog Number: (103007-832)
Supplier: Anaspec Inc
Description: This cell permeable peptide is derived from the BH3 domain (a death domain) of Noxa A, amino acid residues 17 to 36. Eight D-Arginine residues and a Glycine linker residue are added to the amino terminal of the peptide.
Sequence:rrrrrrrrGAELPPEFAAQLRKIGDKVYC
MW:3555.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102999-364

[Lys0]-Bradykinin (Kallidin)

Catalog Number: (102999-364)
Supplier: Anaspec Inc
Description: [Lys0]-BK(1-10) is one of the two main Bradykinin peptides that act as a mediator of inflammation with evidence showing its release at high nanomolar concentrations into the tear-film of ocular allergic patients.
Sequence:KRPPGFSPFR
MW:1188.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Image Unavailable-103006-278

CEF Control Peptide Pool

Catalog Number: (103006-278)
Supplier: Anaspec Inc
Description: This product contains 0.5 mg of the 32 CEF peptides for a total of 16 mg in one vial. Used in the stimulation of IFNγ release from CD8+ T cells in individuals with defined HLA types, these epitopes are useful in applications such as ELISPOT, intracellular cytokine and CTL assays.
% peak area by HPLC: ≥ 95
Storage condition: -20°C
Image Unavailable-103003-180

Human Beta-Amyloid (1-40), HiLyte™ Fluor 555

Catalog Number: (103003-180)
Supplier: Anaspec Inc
Description: This is a fluorescent (HiLyte™ Fluor 555)-labeled ß-Amyloid peptide, Abs/Em = 551/567 nm.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
225 - 240 of 1,910
no targeter for Bottom