Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-102996-086

Human Parathyroid Hormone (1-34), Biotinylated, Biotin

Catalog Number: (102996-086)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4344.1 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-103007-180

Beta-Amyloid A4 Protein Precursor (740-770)

Catalog Number: (103007-180)
Supplier: Anaspec Inc
Description: APP (C31): this 31-amino acid peptide corresponds to the C-terminal fragment of the Amyloid Precursor Protein (APP). Caspase cleavage of amyloid beta-protein precursor with the generation of C31 may be involved in the neuronal death associated with Alzheimer disease. The resultant C31 peptide is a potent inducer of apoptosis. This peptide is located in lipid rafts together with the APP-BP1, a binding protein for the intracellular domain of APP.
Sequence:AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
MW:3717.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-536

[Lys(Ac)16]-Histone H4 (1-21)-GGK,Biotin

Catalog Number: (103008-536)
Supplier: Anaspec Inc
Description: This peptide is histone H4 amino acids 1 to 16, acetylated at Lys-16 and at the N-terminus. This peptide also contains a GG linker, followed by a biotinylated lysine. The acetylation of histone H4 causes structural changes that play a crucial role in amplifying the binding of transcription factors to specific recognition sites within the nucleosome.
Sequence:Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103011-414

HiLyte™ Fluor 532 hydrazide fluorescent dye

Catalog Number: (103011-414)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 532 hydrazide is a carbonyl-reactive fluorescent labeling dye.
Image Unavailable-103005-328

RGD-4C

Catalog Number: (103005-328)
Supplier: Anaspec Inc
Description: This peptide, a double cyclic peptide, binds preferentially to integrins at sites of tumor angiogenesis and inflammed synovium in-vivo, and can be internalized into targeted cells.
Sequence:ACDCRGDCFCG (Disulfide bridge: 2-10 and 4-8)
MW:1145.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-672

Human Cys-LC-LL-37

Catalog Number: (103007-672)
Supplier: Anaspec Inc
Description: This is cysteine conjugated to LL-37 via a LC linker. This type of modified LL-37 can be used for KLH, BSA or OVA conjugation.
Sequence: C - LC - [LL-37, 37 aa]
MW: 4709.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103009-600

[Arg(Me2s)26]-Histone H3 (15-36)-GGK,Biotin

Catalog Number: (103009-600)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 15-36 with a C-terminal GG linker followed by a biotinylated lysine. It is symmetrically dimethylated at arginine 26 with a methyl group added to each nitrogen of the guanidinium group.
Sequence:APRKQLATKAA-R(Me2s)-KSAPATGGVK-GGK(biotin)
MW:2704.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103011-186

Rhod - 2 AM ≥90% (by HPLC), Ultra Pure Grade

Catalog Number: (103011-186)
Supplier: Anaspec Inc
Description: Long wavelength fluorescent indicator for quantifying intracellular Ca2+ concentration
Image Unavailable-103003-382

Plants Phytochelatin 4

Catalog Number: (103003-382)
Supplier: Anaspec Inc
Description: A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 4 units of gammaGlu-Cys.
Sequence:(γE-C)4-G
MW:1004.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-678

Human Ghrelin Peptide

Supplier: Anaspec Inc
Description: Ghrelin is an appetite stimulating peptide hormone secreted by stomach P/D1-type cells in humans and circulates in the bloodstream during fasting conditions.  Enzymatically n-octanoylated Serine3 of this 28-amino acid Ghrelin, also known as acyl-Ghrelin (AG), is the endogenous ligand specific for growth hormone secretagogue receptor 1a (GHSR1a). The GHSR1a receptor appears to be dedicated to Ghrelin and is widely expressed in different tissues. 
Sequence: GS-S(n-octanoyl)-FLSPEHQRVQQRKESKKPPAKLQPR
MW: 3370.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-103011-056

DABCYL Plus™ C2 maleimide ≥95%

Catalog Number: (103011-056)
Supplier: Anaspec Inc
Description: DABCYL Plus™ C2 maleimide is an excellent thiol-reactive building block for developing DABCYL Plus™-based FRET probes.
Image Unavailable-102998-834

Influenza HA peptide

Supplier: Anaspec Inc
Description: This peptide belongs to the influenza hemagglutinin (HA) family and is responsible for attaching the virus to cell receptors and initiating infection.
The HA tag is used as a general epitope tag in expression vectors. Many recombinant proteins have been engineered to express the HA tag, which does not appear to interfere with the bioactivity or the biodistribution of the recombinant protein. The HA tag is not suitable for detection or purification of proteins from apoptotic cells since it is cleaved by Caspase-3 and / or Caspase-7 after its sequence DVPD, causing it to lose its immunoreactivity.
Sequence:YPYDVPDYA
MW:1102.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103008-620

[pThr11]-Histone H3(1-21)-GGK,Biotin

Catalog Number: (103008-620)
Supplier: Anaspec Inc
Description: This peptide is histone H3 amino acid residues 1 to 21. It is phosphorylated at Thr-11 with a C-terminal GG linker, followed by a biotinylated lysine. The modification of Thr-11 via phosphorylation is processed by a number of enzymes, including protein kinase C-related kinase 1 (PRK1) and Serine/threonine-protein kinase Chk1. This has many important functions, such as the establishment of a novel chromatin marker for transcriptional regulation, and the regulation of DNA-damage induced transcriptional repression. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKS-pT-GGKAPRKQLA-GGK(Biotin)-NH2
MW:2802.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-540

Human Beta-Amyloid (10-26)

Catalog Number: (103007-540)
Supplier: Anaspec Inc
Description: This is amino acids 10 to 26 fragment of beta-Amyloid peptide. It is capable of forming fibrils.
Sequence: YEVHHQKLVFFAEDVGS
Molecular Weight: 2005.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103006-348

GRGDSPK, AnaSpec

Catalog Number: (103006-348)
Supplier: Anaspec Inc
Description: A linear integrin binding peptide. It inhibits endothelial cell adhesion to fibroblast growth factor-2 and to fibronectin.
Sequence:GRGDSPK
MW:715.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-238

520 MMP FRET Substrate I, QXL™ 520-FAM, AnaSpec

Catalog Number: (103003-238)
Supplier: Anaspec Inc
Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This substrate is hydrolyzed rapidly by MMP-13, but slowly by MMP-1, 2, 3, 8, 9 and 12, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PLGLWArK(5-FAM)-NH2
MW:1789.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
449 - 464 of 1,910
no targeter for Bottom