You Searched For: Hytest Ltd

Catalog Number: (103006-578)

Supplier: Anaspec Inc

Description: This peptide is derived from the human mucin MUC5AC gene sequence. Data suggest that MUC5A and MUC5C are part of the same gene MUC5AC, which is distinct from MUC5B. The gene MUC5AC is mainly expressed in gastric, tracheo-bronchial mucosae and some tumors, it exhibits two kinds of deduced peptide domains, one of which is 8 amino acid tandemly repeated domain, a consensus peptide TTSTTSAP.
Sequence:GTTPSPVPTTSTTSAP
MW:1501.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: This peptide is a fragment of myelin basic protein (MBP), which corresponds to amino acids 88-102 in mouse, 88-104 in guinea pig and 89-105 in human. It is biotinylated in N-term, with a LC linker.
Sequence:Biotin-LC-FFKNIVTPRTPPPSQGK-NH2
MW:2252.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103005-928)

Supplier: Anaspec Inc

Description: PCC (88-104) is a 17-mer peptide fragment of pigeon cytochrome c that stimulates proliferative T cell responses.
Sequence:KAERADLIAYLKQATAK
MW:1890.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-492)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 (21-43) acetylated at lysine 27 with a C-terminal GG linker followed by a biotinylated lysine. The acetylation of histone H3 at lysine 27 is associated with many active mammalian genes. In Arabidopsis thaliana, the acetylated histone at lysine 27 is nontransposable element gene-specific. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Ac)-SAPATGGVKKPHRYRP-GGK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-498)

Supplier: Anaspec Inc

Description: This peptide is a fragment of myelin basic protein (MBP), which was used in multiple sclerosis studies. It corresponds to amino acids 85-106 of the guinea pig sequence, and amino acids 86-107 of the human protein.
Sequence:VVHFFKNIVTPRTPPPSQGKGR
MW:2462.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-940)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 555 C2 maleimide is an excellent thiol-reactive fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy3 dyes, resulting in an optimal match to filters designed for Cy3 dyes.

Sale

Supplier: Anaspec Inc

Description: AVP have been identified as an important regulator of fluid and electrolyte homeostasis through its anti-diuretic action on the kidney, After myocardial infarction, plasma levels of [Arg8]-vasopressin rise to recover hemodynamics.
Sequence: CYFQNCPRG-NH2 (Disulfide bridge: 1-6)
MW: 1084.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 21 to 44 mono-methylated at Lys-27 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2931.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-824)

Supplier: Anaspec Inc

Description: 6-ROX, SE is the other purified single isomer of 5(6)-ROX, SE. It appears that 5-ROX is more often used than 6-ROX for labeling peptides and proteins. 6-ROX is predominately used for labeling nucleotides and sequencing nucleic acids.

Sale

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-42) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4399 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (102997-478)

Supplier: Anaspec Inc

Description: These peptides are potential substrates for EGFR protein tyrosine kinases. The fluorescent and biotinylated peptides are used to design assays for CaMKs.
Sequence:ADEYLIPQQ
MW:1076.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102999-808)

Supplier: Anaspec Inc

Description: Sequence: KKPYIL
MW: 761 Da
% peak area by HPLC: 95%
Storage condition: -20°C

Sale

Catalog Number: (103004-134)

Supplier: Anaspec Inc

Description: Charybdotoxin (ChTX) is a Ca2+-activated K+ channel blocker. It depolarizes peripheral T lymphocytes and blocks their mitogen-induced proliferation. ChTX is a highly basic peptide isolated from venom of the scorpion, Leiurus quinquestriatus hebraeus.
Sequence:Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
MW:4296 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-770)

Supplier: Anaspec Inc

Description: This is a FAM labeled peptide substrate (Abs/Em = 494/521 nm) for C-terminal Src kinase (Csk) and many other kinases such as Axl, cKit, ERBB4, Fes, Flt3, IGF-1 R, MET, MUSK, PYK2, Ret, TIE2, TrkA, VEGF-R1 and VEGF-R2.
Sequence:5-FAM-KKKKEEIYFFFG-NH2
MW:1921.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-676)

Supplier: Anaspec Inc

Description: The SensoLyte® Green Glutaminyl Cyclase Activity Assay Kit provides a convenient, two-step homogeneous procedure for measuring enzyme activity from various sources using a green fluorescence substrate

Sale

Catalog Number: (103009-192)

Supplier: Anaspec Inc

Description: This is histone H4 (1-25) with a C-terminal GSGS linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKGGKGLGKGGAKRHRKVLRDN-GSGSK(Biotin)
MW:3232.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale