You Searched For: Hytest Ltd

Catalog Number: (102996-406)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Supplier: Anaspec Inc

Description: Aß (1-28) is highly hydrophilic and shares sequences with bA4, the major component of Aß. Its assembly is fibrillar, i.e., elongated in a single direction. Reports show that synthetic peptides Aß (1-40) and Aß (1-28) have significant effects on normal human plasma cholesterol esterification rate.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK
Molecular Weight: 3262.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103006-416)

Supplier: Anaspec Inc

Description: This is a biotinylated HIV-derived cell penetrating TAT peptide . This positively charged biotin-peptide has been used in studies to form a colloidal coat over oligonucleotides-saturated nanoparticles such that TAT-coated nanoparticles when loaded with dense SiRNA molecules could efficiently penetrate a wide variety of human embryonic stem cells.
Sequence: Biotin-YGRKKRRQRRR
MW: 1786.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (102997-140)

Supplier: Anaspec Inc

Description: HLA-A*0201 restricted epitope from influenza virus RNA polymerase subunit, PA (46-54).
Sequence: FMYSDFHFI
MW: 1206.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103006-984)

Supplier: Anaspec Inc

Description: MLC-derived peptide, a protein kinase associated with apoptosis and tumor suppression.
Sequence:KKRPQRRYSNVF
MW:1578.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-558)

Supplier: Anaspec Inc

Description: This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
Sequence:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
MW:3878.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103011-304)

Supplier: Anaspec Inc

Description: 10-Acetyl-3,7-dihydroxyphenoxazine (ADHP), also called Amplex® Red and Ampliflu™ Red, is not only a sensitive and stable fluorogenic substrate for HRP but also an ultrasensitive probe for H2O2. In the presence of HRP and H2O2, ADHP generates highly fluorescent resorufin that has maximum absorption of 571 nm and maximum emission of 585 nm. Unlike other HRP substrates such as dihydrofluoresceins and dihydrorhodamines, the air-oxidation of ADHP is minimal. So far ADHP has been known as the most sensitive and stable fluorogenic probe for detecting HRP and H2O2. ADHP has been widely used to detect HRP in many immunoassays. On the other hand, Zhou, et al. have demonstrated that ADHP can be used to detect trace amount of H2O2. The ADHP-based H2O2 detection is at least one order of magnitude more sensitive than the commonly used scopoletin assay for H2O2. Because H2O2 is produced in many enzymatic redox reactions, ADHP can be used in coupled enzymatic reactions to detect the activity of many oxidases and/or related enzymes/substrates or cofactors such as glucose, acetylcholine and cholesterol, L-glutamate, amino acids, etc. We offer the best quality of ADHP with the most competitive price. The reagent can be purchased in a single 25 mg vial or can be custom-packaged to meet your special requirements.

Sale

Supplier: Anaspec Inc

Description: This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R).
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
MW: 4541.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103006-678)

Supplier: Anaspec Inc

Description: This peptide sequence is found in residues 89 to 113 of human MOG (Myelin Oligodendrocyte Glycoprotein). Studies suggest this is an HLA-DR2 restricted MOG epitope.
Sequence: RFSDEGGFTCFFRDHSYQEEAAMEL
MW: 2973.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103008-346)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1-21. It is monomethylated at lysine 9 with a C-terminal GG linker followed by a biotinylated lysine. The monomethylation of histone H3 at lysine 9 is dynamically and sex-differentially regulated during meiotic prophase. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2736.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: HiLyte™ Fluor594 acid, SE is an amine reactive reagent for labeling peptides, proteins and antibodies.

Catalog Number: (103008-106)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 21. It is phosphorylated at Ser10 with a C-terminal GG linker followed by a biotinylated lysine. The phosphorylation of Histone H3 at Ser10 is a mitotic marker and is associated with chromosome condensation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARK-pS-TGGKAPRKQLA-GGK(Biotin)-NH2
MW:2802.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Supplier: Anaspec Inc

Description: Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), Cat AS-20610, is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYP
MW: 2933.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (102996-346)

Supplier: Anaspec Inc

Description: The intrastriatal perfusion with the neurotensin(1-13) [NT(1-13)] and its active fragment NT(8-13) on striatopallidal GABA leads to the increased striatal and pallidal GABA release, and this effect is antagonized by intrastriatal perfusion with the NT receptor antagonist. Neurotensin(8-13) is as potent as neurotensin but ineffective in [D-Tyr(11)]neurotensin. In the caudal nucleus accumbens, neurotensin(8-13) and neurotensin appears more potent than [D-Tyr(11)]neurotensin. In contrast, in the rostral nucleus accumbens, neurotensin(8-13) is less potent than [D-Tyr(11)]neurotensin and neurotensin.
Sequence:RRPYIL
MW:817 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: Myelin oligodendrocyte glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system. It is a glycoprotein observed to be important in the myelination of nerves. It is a central molecule actively studied for its role in Multiple Sclerosis. MOG (35-55) is able to induce autoantibody production and relapsing-remitting neurological disease causing extensive plaque-like demyelination. Autoantibody response to MOG (35-55) has been observed in multiple sclerosis (MS) patients and MOG (35-55)-induced experimental autoimmune encephalomyelitis (EAE) C57/BL6 mice and Lewis rats.
Sequence: MEVGWYRSPFSRVVHLYRNGK
MW: 2582 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103007-720)

Supplier: Anaspec Inc

Description: This is a chromogenic substrate for thrombin, Abs=405 nm.
Sequence:f - Pip - R - pNA
MW:552.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale