You Searched For: Hytest Ltd

Catalog Number: (102999-366)

Supplier: Anaspec Inc

Description: This is a CGRP receptor antagonist.
Sequence:VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF-NH2
MW:3125.6 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (102996-752)

Supplier: Anaspec Inc

Description: This peptide, containing the consensus sequence XKYX(P/V)M, is found to stimulate phospholipase C (PLC)-mediated formation of InoPs in certain cell lines and human neutrophils. WKYMVm-NH2 may have the ability to activate the microbicidal functions of human neutrophils.
Sequence:WKYMVm-NH2
MW:856.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103009-034)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (44-63) with acetylation at Lys56. Lys56 acetylation occurs during premeiotic and mitotic S phases and persists through DNA damage repair and is catalyzed by the Rtt109-Vps75 histone acetyltransferase (HAT) complex. A deficiency of acetylated Lys56 in histone H3 is implicated in spontaneous chromosome breaks during mitosis, suggesting that this modification is important for replisome integrity and DNA replication.
Sequence:GTVALREIRRYQ-K(Ac)-STELLIR
MW:2444.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103008-462)

Supplier: Anaspec Inc

Description: The octapeptide angiotensin II (Ang II) exerts a wide range of effects on the cardiovascular system. It is also implicated in the regulation of cell proliferation, fibrosis and apoptosis. Ang II is formed through cleavage of Ang I by the angiotensin-conve
Sequence: DRVY-I*-HPF [I*= I(U13C6,15N)]
MW: 1053.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Sale

Catalog Number: (103007-514)

Supplier: Anaspec Inc

Description: This is a heptapeptide from the N-terminal prion-determining domain of the yeast protein Sup35 that forms amyloid fibrils. The availability of its detailed atomic oligomeric structure makes it a good model for studying the early stage of aggregation. The GNNQQNY dimer forms three stable sheet structures. in-register parallel, off-register parallel, and anti-parallel. The in-register parallel dimer, which is close to the amyloid beta-sheet structure, has few interpeptide hydrogen bonds, making hydrophobic interactions more important and increasing the conformational entropy compared to the anti-parallel sheet.
Sequence: GNNQQNY
Molecular Weight: 836.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103008-232)

Supplier: Anaspec Inc

Description: R16 is an IRBP (Interphotoreceptor retinoid binding protein) derived peptide. Photoreceptor cell protein is capable of inducing an experimental autoimmune uveitis (EAU) in susceptible animal strains.
Sequence:ADGSSWEGVGVVPDV
MW:1473.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-382)

Supplier: Anaspec Inc

Description: TAMRA is one of the most popular fluorophores used in various bioconjugations. 5-TAMRA is the purified single isomer of 5(6)-TAMRA. It is preferred for some complicated biological applications where reproducibility is more critical than material cost since the minor positional difference between 5-TAMRA and 6-TAMRA might affect some biological properties of the underlying conjugates.

Sale

Catalog Number: (102996-882)

Supplier: Anaspec Inc

Description: The peptide sequence, ERMRPRKRQGSVRRRV (cat# 27183-1), corresponds to pseudosubstrate region of the ε-isotype of protein kinase C (PKCε) with an alanine to serine substitution. PKCε exhibits an apparent specificity for the native peptide (Km = 68 µM).
Sequence:ERMRPRKRQGSVRRRV
MW:2067.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103009-196)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-25) with acetylation at Lys5, Lys8, Lys12, and Lys16, followed by a C-terminal GSGS linker and a biotinylated lysine. Acetylation at Lys5, Lys8, and Lys12 is carried out by p300 protein while acetylation at Lys16 is regulated by several histone acetyltransferases. These lysine residues have been shown to have important functions in transcriptional activation, replication, and nuclear division. Acetylation of lysine residues promotes binding of transcription factors to histone H4. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDN-GSGSK(Biotin)
MW:3400.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (102999-772)

Supplier: Anaspec Inc

Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: Biotin-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4984.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale

Catalog Number: (102996-070)

Supplier: Anaspec Inc

Description: Magainin 2 assumes an amphiphilic helix when bound to acidic phospholipids, forming a pore composed of a dynamic, peptide-lipid supramolecular complex.
Sequence:GIGKFLHSAKKFGKAFVGEIMNS
MW:2466.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103003-346)

Supplier: Anaspec Inc

Description: A protease-activated receptor (PAR-1) agonist peptide (P5-NH2) identified as the minimal structural motif required for retaining the full agonist activity.
Sequence:SFLLR - NH2
MW:634.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 21 to 44 di-methylated at Lys-27 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me2)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2945.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-020)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1 to 10 tri-methylated at Lys-4.
Sequence:ART-K(Me3)-QTARKS
MW:1188.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale