You Searched For: Hytest Ltd

Catalog Number: (103008-532)

Supplier: Anaspec Inc

Description: This peptide consists of amino acids 1-23 of histone H4 attached at the C-terminal by a GSGS linker to biotinylated lysine. It is used as a substrate for histone acetyltransferase (HAT) assays. Biotinylation allows the peptide to be captured on streptavidin or agarose beads.
Sequence:SGRGKGGKGLGKGGAKRHRKVLR-GSGSK(Biotin)
MW:3003.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-518)

Supplier: Anaspec Inc

Description: This is fragment 18-37 of LL-37, it exhibits enhanced antimicrobial activity. Antimicrobial peptide LL-37, belonging to the cathelicidin family, is the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense (innate immunity) against local infection and systemic invasion of pathogens at sites of inflammation and wounds.
Sequence: KRIVQRIKDFLRNLVPRTES
MW: 2468.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Sale

Catalog Number: (103006-988)

Supplier: Anaspec Inc

Description: Cathepsins are a class of globular lysosomal proteases, playing a vital role in mammalian cellular turnover. They degrade polypeptides and are distinguished by their substrate specificities. Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown. Cathepsin D is involved in the pathogenesis of several diseases such as breast cancer and Alzheimer disease. Cathepsin E is a non-lysosomal aspartic proteinase of the pepsin superfamily. It plays an important role in the protein degradation, the generation of bioactive proteins, and antigen processing. Recent studies have particularly suggested that Cathepsin E is important in host defense against cancer cells and invading microorganisms.
An internally quenched fluorogenic substrate (Ab/Em =328/393 nm) for cathepsins D and E and not for B, H or L, obtained from the hepatopancreas (liver) of the Japanese common squid (Todarodes pacificus). The cleavage occurs at the Phe-Phe amide bond resulting in enhanced fluorescence and is used in screening cathepsin D and E inhibitors and for determining cathepsin D and E activity in tissue cell extracts.
Sequence:Mca-GKPILFFRLK(Dnp)-r-NH2
MW:1756.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103009-620)

Supplier: Anaspec Inc

Description: This peptide is Histone H4 amino acid residues 1-25. It is acetylated at lysine 5/8/12/16.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGSK
MW:2373.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-662)

Supplier: Anaspec Inc

Description: Neprilysin (NEP) is a transmembrane metallopeptidase normally expressed by a variety of tissues

Sale

Catalog Number: (103010-794)

Supplier: Anaspec Inc

Description: 6-HEX, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.

Sale

Catalog Number: (103008-028)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 23 to 34.
Sequence:KAARKSAPATGG
MW:1114.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103007-188)

Supplier: Anaspec Inc

Description: This peptide corresponds to the myelin basic protein (MBP) encephalitogenic epitope used to induce experimental autoimmune encephalomyelitis (EAE) in rats. It corresponds to amino acids 69-85 from guinea pig MBP.
Sequence:YGSLPQKSQRSQDENPV
MW:1933.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-504)

Supplier: Anaspec Inc

Description: The calpains are a family of intracellular Ca²⁺ dependent cysteine proteases

Sale

Catalog Number: (103008-422)

Supplier: Anaspec Inc

Description: Kisspeptin was originally identified as a human metastasis suppressor gene that has the ability to suppress melanoma and breast cancer metastasis. Kisspeptin-GPR54 signaling has an important role in initiating secretion of gonadotropin-releasing hormone (GnRH) at puberty from the anterior pituitary.
This amidated peptide sequence is found in C-terminal residues 110 to 119 of the neurohormone Metastin (also referred to as Kisspeptin-10); it increases plasma concentrations of GH (Growth Hormone) and LH (Luteinizing Hormone).
Sequence:YNWNSFGLRY-NH2
MW:1318.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103010-638)

Supplier: Anaspec Inc

Description: AnaSpec's AggreSure™ beta-Amyloid (1-40) peptide is pretreated and tested for aggregation using AnaSpec's SensoLyte® ThT Aβ40 Aggregation kit (Cat# AS-72213).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (103003-360)

Supplier: Anaspec Inc

Description: α-CGRP is preferentially expressed in sensory neuron. Both alpha-CGRP and beta-CGRP increase the rate and force of atrial contractions.
Sequence:SCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAF-NH2 (Disulfide bridge: 2-7)
MW:3806.3 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Sale

Catalog Number: (103007-778)

Supplier: Anaspec Inc

Description: Pep-1 is one of the synthetic cell-penetrating peptides (CPPs), which has been successfully used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive way. It is a CPP with primary amphipathicity (i.e amphipathicity resulting from the amino acid sequence itself, not from the folding structure) that comprises a tryptophan-rich so-called ‘hydrophobic’ domain, a hydrophilic domain derived from an NLS (nuclear localization signal) of SV40 (simian virus 40) large T-antigen, and a spacer between them. A cysteamine group is present at the C-terminus. The presence of cysteamine group in C terminal seems to play a crucial role in the delivery efficiency of cargoes into cells.
Sequence:Ac-KETWWETWWTEWSQPKKKRKV-cysteamine
MW:2950.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103001-640)

Supplier: Anaspec Inc

Description: This SensoLyte® high-sensitivity (2pg/mL) beta-Amyloid (1-42) Quantitative ELISA Kit (Mouse/Rat) provides a convenient and quantitative assay for determining mouse/rat beta-Amyloid (1-42) (Aβ42) amount in cell and tissue lysate as well as in body fluids

Sale

Catalog Number: (103007-304)

Supplier: Anaspec Inc

Description: The GRGDS peptide contains the amino acid sequence Arg-Gly-Asp (RGD), which has been implicated as a recognition site in interactions between extracellular matrix (ECM) molecules and cell membrane receptors. RGD-containing synthetic peptides are known to inhibit attachment of endothelial cells to substrates. GRGDS peptide inhibits angiogenesis in serum-free collagen gel culture. This synthetic peptide mimics the cellular binding site of many adhesive proteins in the extracellular matrix and causes rounding and detachment of spread cells. This peptide is biotinylated through 6-aminohexanoate (LC) as a spacer.
Sequence:Biotin-LC-GRGDS
MW:830 Da
% peak area by HPLC:95
Storage condition:-20° C

Sale

Catalog Number: (103006-576)

Supplier: Anaspec Inc

Description: This peptide is a fragment of the human aquaporin-2 (AQP2) phosphorylated at Ser261. Protein phosphorylation plays a key role in vasopressin signaling in renal-collecting duct. Phosphorylation at several AQP2 residues including Ser256 and Ser261, is altered in response to vasopressin. It is possible that both sites are involved in vasopressin-dependent AQP2 trafficking.
Sequence: RQSVELH-pS-PQSLPR
MW: 1713.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Sale