You Searched For: Hytest Ltd


1,910  results were found

SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103008-216)
Supplier: Anaspec Inc
Description: This is b-amyloid (1-42) peptide with an N-terminal methionine is labeled with a fluorescent dye, 5-TAMRA (Ex/Em= 544/572 nm), on the N-terminus.
Sequence: 5-TAMRA-MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 5057.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Supplier: Anaspec Inc
Description: This is a Histone 3 lysine 36 dimethylated peptide. This peptide has been shown to recruit histone deacetylase complex with nucleosomes and repress transcription. In addition, owing to its epigenetic repressive mark, it allows demethylation by a Jumonji C-domain family member, JMJD5 that functions as a transcription activator by inhibiting HDAC, and regulates cell cycle proliferation.
Sequence:ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin)
MW:2945.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc
Description: This biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.

Catalog Number: (103008-062)
Supplier: Anaspec Inc
Description: Q4 Peptide (SIIQFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence: SIIQFEKL
MW: 977.2 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Catalog Number: (103007-122)
Supplier: Anaspec Inc
Description: This is the hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42.
Sequence: EDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 1999.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-782)
Supplier: Anaspec Inc
Description: This FAM labeled peptide (Abs/Em=492/518 nm) is composed of gp91phox sequence linked to the human immunodeficiency virus (HIV)-tat peptide. The tat sequence facilitates the entry of this peptide into all cells. It is used as a peptide inhibitor for NADPH oxidase assembly.
Sequence: 5-FAM-YGRKKRRQRRRCSTRIRRQL-NH2
MW: 3031.5 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103010-822)
Supplier: Anaspec Inc
Description: Single isomers of ROX are increasingly preferred for labeling peptides and nucleotides because they give better resolution in HPLC purifications that are often required in bioconjugations. Variable ratios of the 5- and 6-isomers often cause complications in the interpretation of labeling results and assay performances.


Catalog Number: (103008-450)
Supplier: Anaspec Inc
Description: This is amino acids 73 to 92 fragment of bone morphogenetic protein (BMP) knuckle epitope. It is a member of transforming growth factor beta (TGF-B). This peptide fragment is able to raise alkaline phosphate activity in murine multipotent mesenchymal cell
Sequence:KIPKASSVPTELSAISTLYL
MW:2118.5 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103009-960)
Supplier: Anaspec Inc
Description: KALA is a cationic amphipathic cell-penetrating peptide (CPP). It assumes an alpha-helix conformation when the pH is 7.5. KALA binds oligonucleotides and disrupts cell membrane; therefore, it can be used as a DNA transfection reagent.
Sequence:WEAKLAKALAKALAKHLAKALAKALKACEA
MW:3131.8 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Anaspec Inc
Description: 6-FAM is another isomer of carboxyfluorescein. 6-FAM, SE is mainly used in sequencing of nucleic acids and labeling nucleotides.

Catalog Number: (103009-380)
Supplier: Anaspec Inc
Description: This peptide is histone H3 (69-89) biotinylated through the epsilon side chain of a C-terminal Lys. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDFKTDLRFQSSAV-K(Biotin)
MW:2834.3 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103006-094)
Supplier: Anaspec Inc
Description: This kit consists of two calibration mixtures for calibrating mass scale in MALDI-TOF or ESI mass spectrometry. Calibration Mixture 1 ranges from 800 to 1800 daltons, and Calibration Mixture 2 from 1800 to 3800 daltons.
Sequence:
MW:
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103007-366)
Supplier: Anaspec Inc
Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103010-904)
Supplier: Anaspec Inc
Description: NBD-X, succinimidyl ester ≥95% (by HPLC)


Catalog Number: (103003-274)
Supplier: Anaspec Inc
Description: TET 830 modified/T-helper epitope from tetanus toxoid is a universal human tetanus toxin T cell epitope. It induces T-cell activation and is used as a helper peptide in vaccinations.
Sequence:AQYIKANSKFIGITEL
MW:1797.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103008-962)
Supplier: Anaspec Inc
Description: TACE (tumor necrosis factor-alpha converting enzyme), α-secretase, or ADAM17 is a member of the ADAM family of proteases that contain both disintegrin and metalloprotease (catalytic) domains


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
145 - 160 of 1,910
no targeter for Bottom