You Searched For: honeywell+deblocking

Description: This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 1-42.
Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4514.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: 103000-620

Supplier: Anaspec Inc

Sale

Description: A non-sulfated CCK Octapeptide. Cholecystokinin (CCK) acts both as a hormone and a neurotransmitter and is found in the GI system and the central nervous system. It is a satiety peptide that inhibits food intake.
Sequence: DYMGWMDF-NH2
MW: 1063.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: 102996-102

Supplier: Anaspec Inc

Sale

Description: This is a fluorescent (HiLyte™ Fluor 488)-labeled Endothelin 1 (ET-1) peptide, Abs/Em=503/528 nm.
Sequence:HiLyte™ Fluor 488-CSCSSLMDKECVYFCHLDIIW (Disulfide Bridge: 1-15 and 3-11)
MW:2848.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: 103008-468

Supplier: Anaspec Inc

Sale

Description: CREBtide is a synthetic substrate for PKA (Km = 3.9 µM). This peptide is based on the phosphorylation sequence in δ-CREB (cAMP response element binding protein).
Sequence:KRREILSRRPS-pY-RK
MW:1925.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103000-570

Supplier: Anaspec Inc

Sale

Description: This peptide corresponds to human, bovine (119-126), mouse, rat (118-125) and Heparin-Binding Growth Factor 2 (118-125) residues of bFGF. It inhibits dimerization and activation of bFGF receptors.
Sequence:KRTGQYKL
MW:993.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-334

Supplier: Anaspec Inc

Sale

Description: Mass spec standard
Sequence:DAF-L*-GSF-L*-YEYSR [L* = L(U13C6, 15N)]
MW:1581.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-434

Supplier: Anaspec Inc

Sale

Description: This serine substituted PLP (139-151) causes severe, acute experimental allergic encephalomyelitis in SJL mice.
Sequence: HSLGKWLGHPDKF
MW: 1521.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: 103004-226

Supplier: Anaspec Inc

Sale

Description: Pep-1 is one of the synthetic cell-penetrating peptides (CPPs), which has been successfully used to deliver a variety of proteins and other biopharmaceutical macromolecules into cells in a non-disruptive way. It is a CPP with primary amphipathicity (i.e amphipathicity resulting from the amino acid sequence itself, not from the folding structure) that comprises a tryptophan-rich so-called ‘hydrophobic’ domain, a hydrophilic domain derived from an NLS (nuclear localization signal) of SV40 (simian virus 40) large T-antigen, and a spacer between them.
Sequence:KETWWETWWTEWSQPKKKRKV
MW:2848.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103006-480

Supplier: Anaspec Inc

Sale

Description: QXL® 570 dyes are optimized quenchers for rhodamines (such as TAMRA, sulforhodamine B, ROX) and Cy3 fluorophores.

Catalog Number: 103010-228

Supplier: Anaspec Inc

Sale

Description: This peptide is derived from the Neh2 domain of nuclear factor (erythroid-derived 2)-like 2, or Nrf2. Nrf2 is a bZIP transcription factor that regulates the expression of antioxidative and cytoprotective genes. The DxETGE motif of this peptide binds Keap1 Kelch adaptor protein and displaces Nrf2 from Keap1.
Sequence:LQLDEETGEFLPIQ
MW:1631.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103009-894

Supplier: Anaspec Inc

Sale

Description: This peptide is derived from Large T antigen residue 47 to 55 (PKKKRKVED). It is a commonly used nuclear localization signal (NLS) peptide. It enables protein import into cell nucleus.
Sequence:CGGGPKKKRKVED
MW:1401.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-760

Supplier: Anaspec Inc

Sale

Description: This is amino acids 17 to 26 fragment of p53, fluorescent labeled through an LC spacer. This peptide is the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that come into contact with the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development, FITC (Abs/Em=493 nm/517 nm)..
Sequence:FITC-LC-ETFSDLWKLL-NH2
MW:1753.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-320

Supplier: Anaspec Inc

Sale

Description: This peptide is derived from Histone H3 21-44 amino acids, and is usually used as a substrate for methylation assays. It has been used as a substrate for protein arginine methyltransferases
Sequence:ATKAARKSAPATGGVKKPHRYRPG
MW:2505.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-180

Supplier: Anaspec Inc

Sale

Description: Protein A-HiLyte™ Fluor 555 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (orange) Excitation/Emission wavelength: 553 nm/568 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development

Catalog Number: 103010-694

Supplier: Anaspec Inc

Sale

Description: This cyclic peptide is designed to mimic the most critical tumor necrosis factor (TNF) recognition loop on TNF receptor I. It prevents interactions of TNF with its receptor. This TNF antagonist is a useful template for the development of small molecular inhibitors to prevent both inflammatory bone destruction and systemic bone loss in rheumatoid arthritis.
Sequence:YCWSQYLCY (Disulfide bridge: 2-8)
MW:1226.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103007-426

Supplier: Anaspec Inc

Sale

Description: This peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-4.
Sequence:ART-K(Me1)-QTARKS
MW:1160.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: 103008-016

Supplier: Anaspec Inc

Sale