You Searched For: Berlinger & Co. AG


4  results were found

SearchResultCount:"4"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (103002-742)
Supplier: Anaspec Inc
Description: Aminopeptidase N Ligand (CD13), NGR peptide, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 606.7, Sequence: (One-Letter Code) CNGRCG (Disulfide bridge: 1-5), Appearance: White Powder, Storage: At -20 Degree C, Size: 5mg


Catalog Number: (103006-800)
Supplier: Anaspec Inc
Description: GAD65 (206-220), used to test whether IL-10 interferes with expression of CTLA-4, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): TYEIAPVFVLLEYVT, Molecular weight: 1757.1, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103005-986)
Supplier: Anaspec Inc
Description: Biotin - Caspase 1 Inhibitor II, Purity: By HPLC >/= 95%, MW: 725.3, Sequence: (One-Letter Code): Biotin-YVAD-CMK Caspase1 Inhibitor II is also known as IL-1B Converting Enzyme (ICE), Physical State: White Powder, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-500)
Supplier: Anaspec Inc
Description: PLP (178-191), Sequence: NTWTTCQSIAFPSK, Purity: By HPLC greater than or equal to 95%, an immunodominant encephalitogenic epitope in SJL mice, one of two major encephalitogenic epitopes, Molecular Weight: 1583.8, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-650)
Supplier: Anaspec Inc
Description: [Lys(Me2)9]-Histone H3 (1-21)-K(Biotin) H3K9(Me2), biotin-labeled, Sequence: ARTKQTAR-K(Me2)-STGGKAPRKQLA-K(Biotin), Purity: By HPLC >/= 95%, residues 1 to 21. Lysine 9 is di-methylated, Molecular Weight: 2637.1, Size: 1 mg


Catalog Number: (103010-692)
Supplier: Anaspec Inc
Description: Protein A - HiLyte* Fluor 488 Conjugate, Purity: >95% SDS-PAGE, Fluorescence: Green Fluorescence, Excitation/Emission wavelength= 499 nm/523 nm, Applications: to detect primary antibodies in IHC from many species rabbit, human, size: 1 mg


Catalog Number: (102971-776)
Supplier: Anaspec Inc
Description: Apelin - 12 Peptide, Purity: greater than or equal to 95% by HPLC, These peptides lowers blood pressure via a nitric oxide-dependent mechanism and involved in the central control of feeding by stimulating cholecystokinin (CCK) secretion, Storage: -20 deg C, Size: 1mg


Catalog Number: (102996-398)
Supplier: Anaspec Inc
Description: Vasoactive Intestinal Peptide, human, porcine, rat, Purity: HPLC >/= to 95%, Molecular Weight: 3684.2, Sequence: FAM-HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, label: FAM, This is a fluorescent (FAM)-labeled VIP, Abs/Em=492/518 nm, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (102999-852)
Supplier: Anaspec Inc
Description: Beta - Amyloid (1 - 43), Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT, Purity: HPLC >/- 95%, Molecular Weight: 4615.2, Solid AB (1-43) fibril is the most fibrillogenic of all the AB peptides, Apperance: Powder, Storage: -20 C, Size: 0.5 mg


Catalog Number: (103009-738)
Supplier: Anaspec Inc
Description: Tau Peptide (275-305) (Repeat 2 domain), Purity: HPLC >/= 95%, Molecular weight: 3263.77, Sequence: VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS] TAU proteins belong to the microtubule-associated protein (MAP) family, Store: -20 deg C, Size: 1mg


Catalog Number: (103010-526)
Supplier: Anaspec Inc
Description: SensoLyte* 520 Mouse Renin Assay Kit *Fluorimetric*, Components: Mouse renin substrate 50 ul, 5-FAM 100 u
M, 10 ul, Mouse Prorenin 0.5 mg/mL, 20 ul, Assay buffer 25 mL, Trypsin Activation buffer 300 ul, Trypsin Inhibitor 10 mM, 20 ul, Renin Inhibitor 1 mM,10 ul


Catalog Number: (103003-038)
Supplier: Anaspec Inc
Description: Beta-Amyloid (1-33), Human, Purity: Greater than or equal to 95%(By HPLC), Molecular weight: 3674, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG, Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer AEszett (1-40) peptide, Storage: At -20 degree C, Size: 1mg


Catalog Number: (103004-224)
Supplier: Anaspec Inc
Description: MBP (87 - 99), human, Purity: Peak Area By HPLC greater than or equal to 95%, Molecular Weight 1555.9, Sequence (One-Letter Code): VHFFKNIVTPRTP, Physical State: Solid, Storage: -20 degree C Store away from oxidizing agent, Size: 1 mg


Catalog Number: (103011-024)
Supplier: Anaspec Inc
Description: 5-FITC cadaverine, Synonym: 5-((5-Aminopentyl)thioureidyl)fluorescein, fluorescent transglutaminase substrate to label proteins by transaminidation, for biomolecules, Molecular Weight: 564.48, Spectral Properties: Abs/Em = 492/516 nm, Solvent System: DMF or DMSO, Size: 5 mg


Catalog Number: (102996-460)
Supplier: Anaspec Inc
Description: FITC-LC-Antennapedia Peptide, Purity: HPLC >/= to 95%, Molecular Weight: 2748.3, Sequence: FITC-LC-Arg-Gln-Ile-Lys-Ile-Trp-Phe-Gln-Asn-Arg-Arg-Met-Lys-Trp-Lys-Lys-NH2, This is a fluorescent (FITC)-labeled Antennapedia, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-292)
Supplier: Anaspec Inc
Description: Kinase Substrates Library, Group II, biotinylated, 18 distinct peptide mixtures, Storage: -20 deg C, Size: 1 Set


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-111 - -96 of 4
no targeter for Bottom