Print…

You Searched For: Hytest Ltd


1,910  results were found

Refine Results Sort by
SearchResultCount:"1910"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103008-620

[pThr11]-Histone H3(1-21)-GGK,Biotin

Catalog Number: (103008-620)
Supplier: Anaspec Inc
Description: This peptide is histone H3 amino acid residues 1 to 21. It is phosphorylated at Thr-11 with a C-terminal GG linker, followed by a biotinylated lysine. The modification of Thr-11 via phosphorylation is processed by a number of enzymes, including protein kinase C-related kinase 1 (PRK1) and Serine/threonine-protein kinase Chk1. This has many important functions, such as the establishment of a novel chromatin marker for transcriptional regulation, and the regulation of DNA-damage induced transcriptional repression. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKS-pT-GGKAPRKQLA-GGK(Biotin)-NH2
MW:2802.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-540

Human Beta-Amyloid (10-26)

Catalog Number: (103007-540)
Supplier: Anaspec Inc
Description: This is amino acids 10 to 26 fragment of beta-Amyloid peptide. It is capable of forming fibrils.
Sequence: YEVHHQKLVFFAEDVGS
Molecular Weight: 2005.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103006-348

GRGDSPK, AnaSpec

Catalog Number: (103006-348)
Supplier: Anaspec Inc
Description: A linear integrin binding peptide. It inhibits endothelial cell adhesion to fibroblast growth factor-2 and to fibronectin.
Sequence:GRGDSPK
MW:715.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-238

520 MMP FRET Substrate I, QXL™ 520-FAM, AnaSpec

Catalog Number: (103003-238)
Supplier: Anaspec Inc
Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This substrate is hydrolyzed rapidly by MMP-13, but slowly by MMP-1, 2, 3, 8, 9 and 12, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PLGLWArK(5-FAM)-NH2
MW:1789.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-110

MBP (90-106)

Catalog Number: (103006-110)
Supplier: Anaspec Inc
Description: This peptide is a fragment of myelin basic protein (MBP), which corresponds to amino acids 88-102 in mouse, 88-104 in guinea pig and 89-105 in human. It is acetylated in N-term.
Sequence:Ac-FFKNIVTPRTPPPSQGK-NH2
MW:1956 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102998-170

Threonine Phosphopeptide

Catalog Number: (102998-170)
Supplier: Anaspec Inc
Description: Serine/threonine phosphatase substrate.
Sequence:KR-pT-IRR
MW:909 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-928

Bid BH3-r8

Catalog Number: (103006-928)
Supplier: Anaspec Inc
Description: The Bid BH3 is a pro-apoptotic member of the 'BH3-only' subset of BCL-2 family proteins that constitute a critical control point in apoptosis. r8BIDBH3 is lethal to human leukemia cell lines that expresse Bcl-2. The Bcl-2 antagonists may have the potential to be efficacious in cancer therapy. Poly-D-arginine (d-isomer as denoted by rrrrrrrr) is fused to the Bid BH3 peptide to facilitate cellular uptake of the peptide.
Sequence:RRRRRRRRGEDIIRNIARHLAQVGDSMDR
MW:3616.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-752

Chemerin (149-157)

Catalog Number: (103007-752)
Supplier: Anaspec Inc
Description: This peptide is amino acid residue 149 to 157 of chemerin, a natural ligand of ChemR23, a G protein-coupled receptor expressed in immature dendritic cells and macrophages. This peptide retains most of the activities of the full size protein including ligand binding to chemerin receptor. It is a chemoattractant factor for human immature dendritic cells (DCs), macrophages, and NK cells, and play a role in skin inflammatory processes.
Sequence:YFPGQFAFS
MW:1063.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-392

Glutamate Receptor Endocytosis Inhibitor

Catalog Number: (103007-392)
Supplier: Anaspec Inc
Description: This GluR23Y peptide was used in ELISA cell-surface assay for the insulin-stimulated endocytosis of native AMPA receptors in cultured hippocampal neurons. GluR23Y prevented any insulin-induced reduction. The blockade of insulin action was observed when the GluR23Y peptide was delivered into neurons by fusing it to the membrane transduction domain of HIV-1.
Sequence:YKEGYNVYG
MW:1092.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-612

Human Beta-Amyloid (1-55)

Catalog Number: (103007-612)
Supplier: Anaspec Inc
Description: Beta-amyloid 1-55 is the the 672-726 fragment of APP.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Molecular Weight: 5982.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103010-980

Fluorescein-5-maleimide

Catalog Number: (103010-980)
Supplier: Anaspec Inc
Description: Maleimides are among the most frequently used reagents for thiol modification. In most proteins, the site of reaction is at cysteine residues that either are intrinsically present or result from reduction of cystines. Unlike iodoacetamides, maleimides do not react with histidines and methionines under physiological conditions. Fluorescein-5-maleimide is one of the most popular fluorescent dyes for thiol modifications of proteins.
Image Unavailable-103007-104

Human Beta-Amyloid (1-17)

Catalog Number: (103007-104)
Supplier: Anaspec Inc
Description: This is beta-Amyloid peptide fragment derived from amino acids 1 to 17. This peptide was employed in the b-Amyloid solubility studies.
Sequence: DAEFRHDSGYEVHHQKL
Molecular Weight: 2068.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103010-420

SensoLyte® 520 Cathepsin S Assay Kit Fluorimetric, AnaSpec, Inc.

Catalog Number: (103010-420)
Supplier: Anaspec Inc
Description: Cathepsin S is a cysteine proteinase involved in the pathogenesis of autoimmune diseases, atherosclerosis, cancer, obesity and related diseases
Image Unavailable-103006-408

Cys(Npys)-(Arg)9

Catalog Number: (103006-408)
Supplier: Anaspec Inc
Description: (Arg)9 is a cell-permeable peptide used for drug delivery. It can traverse the plasma membrane of eukaryotic cells, and can be easily conjugated to the molecule to be internalized
Sequence:C(Npys)RRRRRRRRR-NH2
MW:1680.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-942

RS domain derived peptide

Catalog Number: (103006-942)
Supplier: Anaspec Inc
Description: This peptide is a substrate for Clk/Sty and is phosphorylated by Clk/Sty protein kinase (Km=102 microM).
Sequence:GRSRSRSRSR
MW:1204.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-804

Gila Fluorescein-Trp25-Exendin-4 (FLEX), Fluorescein

Catalog Number: (103007-804)
Supplier: Anaspec Inc
Description: This peptide is Exendin-4 labeled with fluorescein at the Tryptophan residue. FLEX is equipotent to GLP-1(7-36)-amide and exendin-4 as an inhibitor of [125I] GLP-1 binding to the human GLP-1 receptor stably expressed in CHO cells, and maintains full biological potency and efficacy as measured by the stimulation of cAMP accumulation in these cells. FLEX binding to CHO/hGLP-1R membranes results in an increase in fluorescence anisotropy. The binding is specific and saturable (Kd = 2.0 +/- 0.4 nM), and GLP-1(7-36)-amide and Exendin-4 are equipotent inhibitors of FLEX binding to the human GLP-1 receptor. Thus, FLEX is a potent, biologically active ligand that is useful for the study of the binding and functional characteristics of the human GLP-1 receptor.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIE-(Trp-S-FAM)-LKNGGPSSGAPPPS-NH2
MW: 4606.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
977 - 992 of 1,910
no targeter for Bottom