You Searched For: bra20

Catalog Number: (10402-216)

Supplier: Bioss

Description: Involved in the conversion of lanosterol to cholesterol.Expressed in adult heart, brain, pancreas, lung, liver, skeletal muscle, kidney, ovary, prostate, and testis, but not detected in placenta, spleen, thymus, small intestine, colon (mucosal lining), or peripheral blood leukocytes.

Sale

Catalog Number: (76117-200)

Supplier: Bioss

Description: The Ryanodine Receptor (RyR) is the channel responsible for calcium release from muscle cell Sarcoplasmic Reticulum (SR) and also plays a role in calcium regulation in non-muscle cells. The RyR exists as a homotetramer and is predicted to have a short cytoplasmic C-terminus and 4-10 transmembrane domains. The remainder of the protein, termed the "foot" region, is located in the cytoplasm between the transverse tubule and the SR. Mammalian RyR isoforms are the product of three different genes: RyR-1 is expressed predominantly in skeletal muscle and areas of the brain; RyR-2 is expressed predominantly in heart muscle but also found in the stomach, endothelial cells and diffuse areas of the brain; and RyR-3 is found in smooth muscle and the brain (striatum, thalamus and hippocampus). In non-mammalian vertebrates, the RyR isoforms are termed alpha, beta and cardiac which correlate loosely to the mammalian RyR-1, RyR-3 and RyR-2 isoforms respectively.

Sale

Catalog Number: (10324-872)

Supplier: Bioss

Description: Glypicans are glycosylphosphatidylinositol-anchored heparan sulphate proteoglycans, which are thought to modulate signalling by growth factors, including fibroblast growth factors and Wnts. Expression of glypican-4 has been reported in the mouse brain at embryonic day 7 and later stages.

Sale

Catalog Number: (10666-470)

Supplier: Bioss

Description: Huntington disease is associated with the expansion of a polyglutamine tract, greater than 35 repeats, in the HD gene product, huntingtin. HIP1, a membrane-associated protein, binds specifically to the N-terminus of human huntingtin. HIP1 is ubiquitously expressed in different brain regions at low levels and exhibits nearly identical subcellular fractionation as huntingtin. The HIP1 gene locates to the human chromosome 7q11.23. The huntingtin-HIP1 interaction is restricted to the brain and is inversely correlated to the polyglutamine length in the huntingtin, suggesting that loss of normal huntingtin-HIP1 interaction may compromise the membrane-cytoskeletal integrity in the brain. HIP1 contains an endocytic multidomain protein with a C-terminal Actin-binding domain, a central coiled-coil forming region and an N-terminal ENTH domain. HIP1 may be involved in vesicle trafficking; the structural integrity of HIP1 is crucial for maintenance of normal vesicle size in vivo. HIP12 is a non-proapoptotic member of the HIP gene family that is expressed in the brain and shares a similar subcellular distribution pattern with HIP1. However, HIP12 differs from HIP1 in its pattern of expression at both the mRNA and protein level. HIP12 does not directly interact with huntingtin but can interact with HIP1.

Sale

Catalog Number: (10666-474)

Supplier: Bioss

Description: Huntington disease is associated with the expansion of a polyglutamine tract, greater than 35 repeats, in the HD gene product, huntingtin. HIP1, a membrane-associated protein, binds specifically to the N-terminus of human huntingtin. HIP1 is ubiquitously expressed in different brain regions at low levels and exhibits nearly identical subcellular fractionation as huntingtin. The HIP1 gene locates to the human chromosome 7q11.23. The huntingtin-HIP1 interaction is restricted to the brain and is inversely correlated to the polyglutamine length in the huntingtin, suggesting that loss of normal huntingtin-HIP1 interaction may compromise the membrane-cytoskeletal integrity in the brain. HIP1 contains an endocytic multidomain protein with a C-terminal Actin-binding domain, a central coiled-coil forming region and an N-terminal ENTH domain. HIP1 may be involved in vesicle trafficking; the structural integrity of HIP1 is crucial for maintenance of normal vesicle size in vivo. HIP12 is a non-proapoptotic member of the HIP gene family that is expressed in the brain and shares a similar subcellular distribution pattern with HIP1. However, HIP12 differs from HIP1 in its pattern of expression at both the mRNA and protein level. HIP12 does not directly interact with huntingtin but can interact with HIP1.

Sale

Catalog Number: (10666-476)

Supplier: Bioss

Description: Huntington disease is associated with the expansion of a polyglutamine tract, greater than 35 repeats, in the HD gene product, huntingtin. HIP1, a membrane-associated protein, binds specifically to the N-terminus of human huntingtin. HIP1 is ubiquitously expressed in different brain regions at low levels and exhibits nearly identical subcellular fractionation as huntingtin. The HIP1 gene locates to the human chromosome 7q11.23. The huntingtin-HIP1 interaction is restricted to the brain and is inversely correlated to the polyglutamine length in the huntingtin, suggesting that loss of normal huntingtin-HIP1 interaction may compromise the membrane-cytoskeletal integrity in the brain. HIP1 contains an endocytic multidomain protein with a C-terminal Actin-binding domain, a central coiled-coil forming region and an N-terminal ENTH domain. HIP1 may be involved in vesicle trafficking; the structural integrity of HIP1 is crucial for maintenance of normal vesicle size in vivo. HIP12 is a non-proapoptotic member of the HIP gene family that is expressed in the brain and shares a similar subcellular distribution pattern with HIP1. However, HIP12 differs from HIP1 in its pattern of expression at both the mRNA and protein level. HIP12 does not directly interact with huntingtin but can interact with HIP1.

Sale

Catalog Number: (10402-198)

Supplier: Bioss

Description: Involved in the conversion of lanosterol to cholesterol.Expressed in adult heart, brain, pancreas, lung, liver, skeletal muscle, kidney, ovary, prostate, and testis, but not detected in placenta, spleen, thymus, small intestine, colon (mucosal lining), or peripheral blood leukocytes.

Sale

Supplier: MP Biomedicals

Description: Uridine is a nucleoside, contains an uracil attached to a ribose ring (known as a ribofuranose) via a β-N1-glycosidic bond. It is an organic compound of the pyrimidine family, that occurs as one of the four bases coding genetic information in the polynucleotide chain of RNA.
Uridine can increase the rate-limiting step of Phosphatidylcholine synthesis in the brain, Phosphatidylcholine is the major structural and functional component of brain cell membranes. Without phosphatidylcholine, brain cells lose their youthful function and suffer the degenerative structural changes associated with aging. Uridine is thought to aid Alzheimer's Disease due to helping with synaptic connections, which appear to be reduced in the state of Alzheimer's.
Physical Appearance: White Powder
UV/Visible Absorbance: λ max (water)= 260 - 263 nm
Solubility: Soluble in 0.1 N HCl (50 mg/mL-clear, colorless solution) and water (50 mg/mL)

Certificates

Catalog Number: (10269-028)

Supplier: Bioss

Description: Myo-inositol is involved in many important aspects of cellular regulation including membrane structure, signal transduction and osmoregulation. It is taken up into cells by the sodium/myo-inositol cotransporter (SMIT). SMIT activity maintains intracellular concentrations of myo-inositol; it is upregulated in response to hypertonic stress. The human SMIT protein is encoded by the SLC5A3 gene, which maps to chromosome 21q22.12. It is expressed in many human tissues, such as brain, kidney and placenta. Specifically, SMIT is abundantly expressed throughout the whole brain and spinal cord in fetal rat, but is downregulated in adult rat brain with the exception of the choroid plexus, where SMIT expression remains high. In kidney, SMIT localizes to the baso-lateral membranes of the thick ascending limb of Henle (TAL) and the inner medullary collecting duct (IMCD). Impaired SMIT activity is implicated in the pathogenesis of diabetes and Down syndrome.

Sale

Catalog Number: (10434-982)

Supplier: Bioss

Description: The Ryanodine Receptor (RyR) is the channel responsible for calcium release from muscle cell Sarcoplasmic Reticulum (SR) and also plays a role in calcium regulation in non-muscle cells. The RyR exists as a homotetramer and is predicted to have a short cytoplasmic C-terminus and 4-10 transmembrane domains. The remainder of the protein, termed the "foot" region, is located in the cytoplasm between the transverse tubule and the SR. Mammalian RyR isoforms are the product of three different genes: RyR-1 is expressed predominantly in skeletal muscle and areas of the brain; RyR-2 is expressed predominantly in heart muscle but also found in the stomach, endothelial cells and diffuse areas of the brain; and RyR-3 is found in smooth muscle and the brain (striatum, thalamus and hippocampus). In non-mammalian vertebrates, the RyR isoforms are termed alpha, beta and cardiac which correlate loosely to the mammalian RyR-1, RyR-3 and RyR-2 isoforms respectively.

Sale

Supplier: Biosensis

Description: The Biosensis NGF Rapid™ enzyme-linked immunosorbent assay (ELISA) kit is a sandwich ELISA that allows the quantification of human NGF in less than 3 hours in cell culture supernatants, serum, plasma (citrate) and brain extracts only if used as directed.

Catalog Number: (10087-126)

Supplier: Proteintech

Description: FOXO6 is a member of the murine forkhead family of transcription factors. These forkhead transcription factors may play a role in maintenance. FOXO6 mRNA is predominantly expressed in the developing brain, indicating that FOXO6 may play an important role in the nervous system.

Sale

Catalog Number: (10435-002)

Supplier: Bioss

Description: The Ryanodine Receptor (RyR) is the channel responsible for calcium release from muscle cell Sarcoplasmic Reticulum (SR) and also plays a role in calcium regulation in non-muscle cells. The RyR exists as a homotetramer and is predicted to have a short cytoplasmic C-terminus and 4-10 transmembrane domains. The remainder of the protein, termed the "foot" region, is located in the cytoplasm between the transverse tubule and the SR. Mammalian RyR isoforms are the product of three different genes: RyR-1 is expressed predominantly in skeletal muscle and areas of the brain; RyR-2 is expressed predominantly in heart muscle but also found in the stomach, endothelial cells and diffuse areas of the brain; and RyR-3 is found in smooth muscle and the brain (striatum, thalamus and hippocampus). In non-mammalian vertebrates, the RyR isoforms are termed alpha, beta and cardiac which correlate loosely to the mammalian RyR-1, RyR-3 and RyR-2 isoforms respectively.

Sale

Catalog Number: (10434-992)

Supplier: Bioss

Description: The Ryanodine Receptor (RyR) is the channel responsible for calcium release from muscle cell Sarcoplasmic Reticulum (SR) and also plays a role in calcium regulation in non-muscle cells. The RyR exists as a homotetramer and is predicted to have a short cytoplasmic C-terminus and 4-10 transmembrane domains. The remainder of the protein, termed the "foot" region, is located in the cytoplasm between the transverse tubule and the SR. Mammalian RyR isoforms are the product of three different genes: RyR-1 is expressed predominantly in skeletal muscle and areas of the brain; RyR-2 is expressed predominantly in heart muscle but also found in the stomach, endothelial cells and diffuse areas of the brain; and RyR-3 is found in smooth muscle and the brain (striatum, thalamus and hippocampus). In non-mammalian vertebrates, the RyR isoforms are termed alpha, beta and cardiac which correlate loosely to the mammalian RyR-1, RyR-3 and RyR-2 isoforms respectively.

Sale

Supplier: Promega Corporation

Description: Recombinant full-length human CDK5 and human p35 were co-expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. CDK5 is a member of the Cyclin-Dependent Kinase family that is most abundant in the mammalian brain.

Supplier: Anaspec Inc

Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
Molecular Weight: 4131.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C