You Searched For: bra20

Catalog Number: (89416-254)

Supplier: Prosci

Description: NPAS3 Antibody: Neuronal PAS domain protein 3 (NPAS3) is a brain-enriched basic helix-loop-helix PAS domain transcription factor and is broadly expressed in the developing neuroepithelium and has recently found to be disrupted by genetic translocation in a family affected with schizophrenia. It was recently shown to be involved in the regulation of FGF signaling in the dentate gyrus by controlling the expression of the FGF receptor subtype 1 and in turn neurogenesis emanating from this region. NPAS3-null mice were growth-retarded and displayed brain defects that included reduced size of the anterior hippocampus, hypoplasia of the corpus callosum, and enlargement of the ventricles, as well as several behavioral abnormalities. Furthermore, these NPAS3-null mice also exhibited disruptions in several neurosignaling pathways involving glutamate, dopamine, and serotonin. These results demonstrate the essential role played by NPAS3 during structural and functional brain development. At least three isoforms of NPAS3 are known to exist.

Sale

Catalog Number: (10402-214)

Supplier: Bioss

Description: Involved in the conversion of lanosterol to cholesterol.Expressed in adult heart, brain, pancreas, lung, liver, skeletal muscle, kidney, ovary, prostate, and testis, but not detected in placenta, spleen, thymus, small intestine, colon (mucosal lining), or peripheral blood leukocytes.

Sale

Catalog Number: (10338-360)

Supplier: Bioss

Description: Glypicans are glycosylphosphatidylinositol-anchored heparan sulphate proteoglycans, which are thought to modulate signalling by growth factors, including fibroblast growth factors and Wnts. Expression of glypican-4 has been reported in the mouse brain at embryonic day 7 and later stages.

Sale

Catalog Number: (10402-210)

Supplier: Bioss

Description: Involved in the conversion of lanosterol to cholesterol.Expressed in adult heart, brain, pancreas, lung, liver, skeletal muscle, kidney, ovary, prostate, and testis, but not detected in placenta, spleen, thymus, small intestine, colon (mucosal lining), or peripheral blood leukocytes.

Sale

Catalog Number: (10269-044)

Supplier: Bioss

Description: Myo-inositol is involved in many important aspects of cellular regulation including membrane structure, signal transduction and osmoregulation. It is taken up into cells by the sodium/myo-inositol cotransporter (SMIT). SMIT activity maintains intracellular concentrations of myo-inositol; it is upregulated in response to hypertonic stress. The human SMIT protein is encoded by the SLC5A3 gene, which maps to chromosome 21q22.12. It is expressed in many human tissues, such as brain, kidney and placenta. Specifically, SMIT is abundantly expressed throughout the whole brain and spinal cord in fetal rat, but is downregulated in adult rat brain with the exception of the choroid plexus, where SMIT expression remains high. In kidney, SMIT localizes to the baso-lateral membranes of the thick ascending limb of Henle (TAL) and the inner medullary collecting duct (IMCD). Impaired SMIT activity is implicated in the pathogenesis of diabetes and Down syndrome.

Sale

Catalog Number: (10269-040)

Supplier: Bioss

Description: Myo-inositol is involved in many important aspects of cellular regulation including membrane structure, signal transduction and osmoregulation. It is taken up into cells by the sodium/myo-inositol cotransporter (SMIT). SMIT activity maintains intracellular concentrations of myo-inositol; it is upregulated in response to hypertonic stress. The human SMIT protein is encoded by the SLC5A3 gene, which maps to chromosome 21q22.12. It is expressed in many human tissues, such as brain, kidney and placenta. Specifically, SMIT is abundantly expressed throughout the whole brain and spinal cord in fetal rat, but is downregulated in adult rat brain with the exception of the choroid plexus, where SMIT expression remains high. In kidney, SMIT localizes to the baso-lateral membranes of the thick ascending limb of Henle (TAL) and the inner medullary collecting duct (IMCD). Impaired SMIT activity is implicated in the pathogenesis of diabetes and Down syndrome.

Sale

Catalog Number: (77440-544)

Supplier: Bioss

Description: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Sale

Catalog Number: (RL600-401-253)

Supplier: Rockland Immunochemical

Description: Affinity purified anti-beta amyloid detects beta amyloid in ELISA, Immunochemistryand IF. A 40-50 kD band consistent with a higher MW precursor is detected in western blot using whole tissue extracts from mouse brain.

Sale

Catalog Number: (76117-202)

Supplier: Bioss

Description: The Ryanodine Receptor (RyR) is the channel responsible for calcium release from muscle cell Sarcoplasmic Reticulum (SR) and also plays a role in calcium regulation in non-muscle cells. The RyR exists as a homotetramer and is predicted to have a short cytoplasmic C-terminus and 4-10 transmembrane domains. The remainder of the protein, termed the "foot" region, is located in the cytoplasm between the transverse tubule and the SR. Mammalian RyR isoforms are the product of three different genes: RyR-1 is expressed predominantly in skeletal muscle and areas of the brain; RyR-2 is expressed predominantly in heart muscle but also found in the stomach, endothelial cells and diffuse areas of the brain; and RyR-3 is found in smooth muscle and the brain (striatum, thalamus and hippocampus). In non-mammalian vertebrates, the RyR isoforms are termed alpha, beta and cardiac which correlate loosely to the mammalian RyR-1, RyR-3 and RyR-2 isoforms respectively.

Sale

Catalog Number: (10749-896)

Supplier: Prosci

Description: NPAS3 Antibody: Neuronal PAS domain protein 3 (NPAS3) is a brain-enriched basic helix-loop-helix PAS domain transcription factor and is broadly expressed in the developing neuroepithelium and has recently found to be disrupted by genetic translocation in a family affected with schizophrenia. It was recently shown to be involved in the regulation of FGF signaling in the dentate gyrus by controlling the expression of the FGF receptor subtype 1 and in turn neurogenesis emanating from this region. NPAS3-null mice were growth-retarded and displayed brain defects that included reduced size of the anterior hippocampus, hypoplasia of the corpus callosum, and enlargement of the ventricles, as well as several behavioral abnormalities. Furthermore, these NPAS3-null mice also exhibited disruptions in several neurosignaling pathways involving glutamate, dopamine, and serotonin. These results demonstrate the essential role played by NPAS3 during structural and functional brain development. At least three isoforms of NPAS3 are known to exist.

Sale

Catalog Number: (10102-808)

Supplier: Prosci

Description: CYP46A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sale

Catalog Number: (103006-992)

Supplier: Anaspec Inc

Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Molecular Weight: 3787.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Sale

Catalog Number: (89365-160)

Supplier: Genetex

Description: OPRM1, an Opioid Receptor, mediates the effects of opioids such as morphine, heroin, fentanyl, methadone, and beta-endorphin. It is involved in the control of addiction, pain, and other mood-altering disorders. Expression of OPRM1 has been reported mostly in brain and spinal cord.

Sale

Catalog Number: (10424-958)

Supplier: Bioss

Description: ADAM11 was first described as MDC (Metalloproteinase-like disintergin-like cysteine-rich protein) from analysis of human brain libraries, in search of brain-specific proteins. Two splice variants with different carboxyterminal ends were described. The message was found only in the brain in this publication. Another group identified ADAM11 in the human brain, where ADAM11 was thought to be involved in cell migration and spatial patterning. ADAM11 was mapped to 17q21.3, a region of interest for breast cancer, and mutations in ADAM11 are associated with some breast cancers. Retinoic acid caused a doubling in ADAM11 message levels over 24 hours in NT2/D1 cells, a human embryonic carcinoma cell line. ADAM11 null mutant mice have deficits in spatial learning and motor coordination, although they did have normal cell migration and differentiation during development. ADAM11 is a member of the ADAMs family (A Disintegrin And Metalloproteinase), but does not contain the canonical HExxHxxxxH zinc-binding metalloproteinase catalytic site. The domain structure of the full-length ADAM11 includes a signal sequence, propeptide domain, metalloproteinase-like domain, disintegrin-like domain, cys-rich domain, EGF-like domain, a spacer region, then the transmembrane domain and a short cytoplasmic domain.

Sale

Catalog Number: (10448-996)

Supplier: Bioss

Description: Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Sale

Catalog Number: (10228-992)

Supplier: Bioss

Description: ACTH occurs in cells of the anterior pituitary and in neurons in brain. It regulates the corticosteroid production in the adrenal cortex. Beta endorphin and Met enkephalin are endogenous opiates. MSH (melanocyte stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes.

Sale