Print…

You Searched For: Molecular+Bioproducts+Inc.


249,603  results were found

Refine Results Sort by
SearchResultCount:"249603"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-BT217855-250G

Molecular sieve A5 (0.5 nm, 5 Å), beads 3-5 mm (0.12-0.20 in)

Supplier: BeanTown Chemical
Description: CAS: 69912-79-4; EC No: 215-684-8; MDL No: MFCD00131613; RTECS: ZG6800000 Beads Density (g/mL): 1.44 Hygroscopic

SDS

Image Unavailable-103003-732

Human Exendin (9-39)

Supplier: Anaspec Inc
Description: This truncated Exendin-4 peptide, Exendin (9-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (9-39) antagonizes GLP-1–stimulated insulin release after food intake. It is a competitive inhibitor of Exendin-3 and Exendin-4.
Sequence: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 3369.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-10781-870

Mouse Recombinant GDNF (from E. coli)

Catalog Number: (10781-870)
Supplier: PeproTech, Inc.
Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional murine GDNF ligand is a disulfide-linked homodimer consisting of two 15.1 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Murine GDNF is 30.2 kDa.
Image Unavailable-10781-832

Human Recombinant GDNF (from E. coli)

Supplier: PeproTech, Inc.
Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional human GDNF ligand is a disulfide-linked homodimer consisting of two 15 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Human GDNF is 30.4 kDa.

Product Image-BJ34241-250G

Molecular sieve 3A (0.3 nm, 3 Å), Hydranal™ drying agent, for air and gases for Karl Fischer titration, Diameter ~2 mm, Fluka™

Catalog Number: (BJ34241-250G)
Supplier: Honeywell Research Chemicals
Description: Hydranal* Molecular sieve 0.3 nm, Drying agent for air and gases for KF titration, Cas: 7761-88-8, Molar mass:  169.87 g/mol, Container Type: Glass bottle, Pore size: 0.3 nm, Size: 250G

SDS Certificates


Image Unavailable-10774-102

Human Recombinant BD-4 (from E. coli)

Supplier: PeproTech, Inc.
Description: Defensins (alpha and beta) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system. The α-defensins are distinguished from the β-defensins by the pairing of their three disulfide bonds. To date, six human β-defensins have been identified; BD-1, BD-2, BD-3, BD-4, BD-5 and BD-6. β-defensins are expressed on some leukocytes and at epithelial surfaces. In addition to their direct antimicrobial activities, they can act as chemoattractants towards immature dendritic cells and memory T cells. The β-defensin proteins are expressed as the C-terminal portion of precursors, and are released by proteolytic cleavage of a signal sequence and, in some cases, a propeptide sequence. β-defensins contain a six-cysteine motif that forms three intra-molecular disulfide bonds. BD-4 is expressed in the testes, stomach, uterus, neutrophils, thyroid, lungs and kidneys. In addition to its direct antimicrobial activities, BD-4 is chemoattractant towards human blood monocytes. Recombinant Human BD-4 is a 6.0 kDa protein containing 50 amino acid residues.

Image Unavailable-AA87956-A7

Molecular sieve A4 (0.4 nm, 4 Å), pellets, Diameter 1-2mm (0.04-0.08in)

Supplier: Thermo Scientific Chemicals
Description: 1KG

SDS Certificates

Image Unavailable-103003-398

Human Galanin

Catalog Number: (103003-398)
Supplier: Anaspec Inc
Description: Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors. It has been involved in food behavior, regulation of sleep and mood, control of blood pression and nociception, among others.
Sequence:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
MW:3157.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103790-358

Cynomolgus Monkey, Rhesus macaque Recombinant FcRn (FCGRT & B2M) (from HEK293 cells)

Supplier: ACROBIOSYSTEMS
Description: Cynomolgus / Rhesus macaque FcRn / FCGRT&B2M Heterodimer Protein, His Tag (BLI verified), ACROBiosystems

Image Unavailable-103007-962

[Lys(Ac)9]-Histone H3 (1-21)

Catalog Number: (103007-962)
Supplier: Anaspec Inc
Description: This peptide sequence is found in residues 1 to 21 of the histone H3K9(Ac) . H3K9(Ac) is highly localized to the 5’ region of transcription start sites in human genes. Localization of H3K9(Ac)  to the transcriptionally active 5’ region of human genes suggests this peptide is essential for transcription initiation and elongation.
Sequence:ARTKQTAR-K(Ac)-STGGKAPRKQLA
MW:2296.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103010-858

Sulforhodamine 101 acid chloride

Catalog Number: (103010-858)
Supplier: Anaspec Inc
Description: Sulforhodamine 101 acid chloride is quite unstable in water, especially at the higher pH required for reaction with aliphatic amines. Protein modification by this reagent is frequently done at low temperature. This reagent reacts with amine compounds such as amino acids, peptides and proteins to give bright red fluorescent conjugates that are extremely stable, and resistant to protease-catalyzed hydrolysis.
Product Image-470232-056

Molecular Geometry Model Set (VSEPR)

Catalog Number: (470232-056)
Supplier: Mega Molecules
Description: Easily illustrate the 5 VSEPR models.
Image Unavailable-AAAL05454-0I

Molecular sieve A4 (0.4 nm, 4 Å), beads 1-2 mm (0.04-0.08 in)

Supplier: Thermo Scientific Chemicals
Description: Grade: NA, Melting Point C. Boiling Point C: NA. 000-00-0. HYGROSCOPIC

SDS Certificates

Image Unavailable-EM-MX1583C-4

Molecular sieve 3A (0.3 nm, 3 Å), beads Mesh 4 - 8, Supelco®

Catalog Number: (EM-MX1583C-4)
Supplier: MilliporeSigma
Description: Beads.

SDS Certificates


Image Unavailable-10770-882

Human Recombinant HVEM-Fc (from (BTI-Tn-5B1-4) Hi-5 Insect cells)

Supplier: PeproTech, Inc.
Description: HVEM belongs to the TNF Receptor superfamily of transmembrane proteins, and plays a role in the activation of T-cells and other lymphocytes. It is expressed in various cells and tissues, including spleen, thymus, lung, macrophages, and T-cells. HVEM activation induces a signaling cascade that results in the induction of transcription factors NF-κB and AP-1. LIGHT (TNFSF14) and TNF-β (TNFSF1) function as the ligands for HVEM, which can also bind specifically to herpes simplex virus glycoprotein D. Soluble HVEM can act as a “receptor decoy” resulting in inhibition of the activity of the HVEM ligands, LIGHT and TNF-β. Recombinant Human HVEM-Fc is a 376 amino acid fusion protein that contains an N-terminal domain corresponding to the extracellular region of HVEM, and a C-terminal domain corresponding to residues 102 to 330 of human IgG1. The calculated molecular weight of Recombinant Human HVEM-Fc is 41.4 kDa.

Image Unavailable-10771-852

Mouse Recombinant GDNF (from E. coli)

Supplier: PeproTech, Inc.
Description: GDNF is a disulfide-linked, homodimeric neurotrophic factor structurally related to Artemin, Neurturin and Persephin. These proteins belong to the cysteine-knot superfamily of growth factors that assume stable dimeric protein structures. GDNF signals through a multicomponent receptor system, composed of a RET and one of the four GFRα (α1-α4) receptors. GDNF specifically promotes dopamine uptake and survival, and morphological differentiation of midbrain neurons. Using a Parkinson’s disease mouse model, GDNF has been shown to improve conditions such as bradykinesia, rigidity, and postural instability. The functional murine GDNF ligand is a disulfide-linked homodimer consisting of two 15.1 kDa polypeptide chains called monomers. Each monomer contains seven conserved cysteine residues, including Cys-101, which is used for inter-chain disulfide bridging, and others that are involved in the intramolecular ring formation known as the cysteine knot configuration. The calculated molecular weight of Recombinant Murine GDNF is 30.2 kDa.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,337 - 2,352 of 249,603
no targeter for Bottom