Print…

You Searched For: Hytest Ltd


1,339  results were found

Refine Results Sort by
SearchResultCount:"1339"

Sort Results

List View Easy View (new)

Rate These Search Results

Image Unavailable-103010-462

SensoLyte® Luminescent Peroxidase Assay Kit (Luminometric), AnaSpec Inc.

Catalog Number: (103010-462)
Supplier: Anaspec Inc
Description: Peroxidases catalyze oxidation-reduction reactions and play an important role in protecting cell from oxidative injury
Image Unavailable-103007-786

HIV Gp91 TAT Peptide 2

Catalog Number: (103007-786)
Supplier: Anaspec Inc
Description: This peptide is a scrambled sequence of NADPH oxidase assembly peptide inhibitor gp91 ds-tat. It is used as a control peptide. It is two amino acid residues shorter at the N-terminus compared with the scrambled gp91 ds-tat.
Sequence: RKKRRQRRRCLRITRQSR-NH2
MW: 2453 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103008-078

HIV Tat-Glur23y, Scrambled

Catalog Number: (103008-078)
Supplier: Anaspec Inc
Description: Tat-Glur23Y, scrambled is a control peptide. The synthetic peptide (Tat-Glur23Y), containing tyrosine residues, blocks phosphorylation of alpha-amino-3-hydroxy-5-methyl-isoxazole-4-propionic acid (AMPA) receptor endocytosis. However, the scrambled version does not have blockade properties. Previous studies show that Tat-Glur23Y, scrambled increase stress levels in mice, while Tat-Glur23Y reduces stress when administered.
Sequence: YGRKKRRQRRRVYKYGGYNE
MW: 2634 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103003-194

Glycogen synthase 1-10, FAM (Carboxyfluorescein)

Catalog Number: (103003-194)
Supplier: Anaspec Inc
Description: The native peptide, PLSRTLSVSS-NH2 (cat# 60514-1), is a synthetic substrate for Ca2+-calmodulin-dependent protein kinase II (Km = 7.5 µM). Maximal activation of the decapeptide substrate phosphorylation requires the presence of Ca2+ and calmodulin and is dependent on Ca2+ concentration.
Sequence:5-FAM-PLSRTLSVSS-NH2
MW:1403.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-272

Drosophila Antennapedia Peptide

Catalog Number: (103006-272)
Supplier: Anaspec Inc
Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:C(Npys)-RQIKIWFQNRRMKWKK-NH2
MW:2505 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-936

Human Kinase Substrates Library, Group I Peptide,Biotin

Catalog Number: (103006-936)
Supplier: Anaspec Inc
Description: Group I of this 180 distinct peptide mixtures, in combination with Group II of 18 distinct peptide mixtures (cat# 62335), obtained via positional scanning synthetic peptide combinatorial library (PS-SPCL) can provide sequence preference information of the different kinases. Amount provided is 1 mg of peptide mixture x 180 vials. Sequences: Y-A-Z-X-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-Z-X-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-Z-X-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-Z-X-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-Z-S/T-X-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-Z-X-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-Z-X-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-Z-X-A-G-K-K(LC-Biotin)-NH2 Y-A-X-X-X-X-X-S/T-X-X-X-Z-A-G-K-K(LC-Biotin)-NH2 X = degenerate mixture of the 17 natural amino acids excluding cysteine, serine, and threonine. LC = 'long chain' version with an additional aminohexanoic acid spacer between the biotin and lysine side chain. S/T = equimolar mixture of serine and threonine. Z = fixed position varied between the 20 natural amino acids.
Image Unavailable-103006-524

HiLyte™ Fluor 488 hydroxylamine, HCl salt single isomer fluorescent dye

Catalog Number: (103006-524)
Supplier: Anaspec Inc
Description: HiLyte™ Fluor 488 hydroxylamine is a carbonyl-reactive labeling dye, which reacts more readily with aldehydes at physiological pH than other primary amine-containing reagents (such as hydrazides and amines).
Image Unavailable-102998-700

Multiple Antigenic Peptide

Catalog Number: (102998-700)
Supplier: Anaspec Inc
Description: Multiple Antigenic Peptides (MAPs) are synthetic peptides with 4 branches harboring 2 Lysines each. The Lys residues are used as a scaffold to support 8 peptides. MAPs are used to increase the mass of the peptide entity when used as antigen in immunizations. They represent an alternative to carrier proteins, such as BSA or KLH.
Sequence:K4K2KA - NH2
MW:985.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-102998-444

Human Bradykinin

Catalog Number: (102998-444)
Supplier: Anaspec Inc
Description: This peptide is an inhibitor for Angiotensin I Converting Enzyme (ACE I), derived from Bradykinin. ACE I partially suppresses the renin-angiotensin-aldosterone system (RAAS), which regulates blood pressure and may mediate hypertension. ACE I converts angiotensin I to the biologically active peptide angiotensin II using a zinc- and chloride- dependent mechanism.
Sequence: RPPGFSPFR
MW: 1060.2 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103010-222

QXL® 490 acid fluorescent dye

Catalog Number: (103010-222)
Supplier: Anaspec Inc
Description: QXL® 490 dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores.
Image Unavailable-103009-012

Histone H3 (5-23)

Catalog Number: (103009-012)
Supplier: Anaspec Inc
Description: This peptide represents amino acid residues 5-23 of histone H3 and can be used as a substrate for histone acetyl-transferase (HAT) assays.
Sequence:QTARKSTGGKAPRKQLASK
MW:2013.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-264

Bax BH3 peptide (55-74)

Catalog Number: (103007-264)
Supplier: Anaspec Inc
Description: This is a 20–amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models. In addition to disrupting Bax/Bcl-2 and Bax/Bcl-XL, it can promote cytochrome c release from isolated mitochondria. Bax BH3 belongs to the Bcl-2 protein family which consists of both pro-apoptotic and anti-apoptotic members. Bax BH3 acts to regulate apoptosis via governance of the 'intrinsic' pathway of cell death.
Sequence:STKKLSECLKRIGDELDSNM
MW:2267.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-024

[Lys(Me2)9]-Histone H3 (3-17)

Catalog Number: (103008-024)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1 to 10 di-methylated at Lys-9.
Sequence:TKQTAR-K(Me2)-STGGKAPR
MW:1614.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103003-724

Gila Exendin 4

Supplier: Anaspec Inc
Description: Exendin-4 (Exenatide), an agonist of glucagon-like peptide 1 (GLP-1) receptor, induces release of insulin after food intake. Exendin-4 shares a 53% sequence homology with GLP-1. Derived from Gila monster, Heloderma suspectum, Exendin-4 has a longer half life than GLP-1 in the plasma, thus making it a more potent insulinotropic agent.
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
MW: 4186.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Image Unavailable-103008-722

delta PKC (8-17)

Catalog Number: (103008-722)
Supplier: Anaspec Inc
Description: This peptide is derived from the V1 domain of protein kinase C (PKC)d. It inhibits phorbol 12-myristate 13-acetate (PMA)-induced PKCd translocation and activation. Inhibition of PKCd reduces ischemia damage in cardiac and cerebral cells, induces proliferation of fibroblasts, and inhibits graft coronary artery disease in mice.
Sequence:SFNSYELGSL
MW:1116.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-498

[Lys(Ac)27]-Histone H3 (23-34)

Catalog Number: (103009-498)
Supplier: Anaspec Inc
Description: This is histone H3 (23-34) with acetylation at Lys27. Histone H3 acetylated at this residue is the least abundant isoform and is associated with histone deposition in replicating chromatin.
Sequence:KAAR-K(Ac)-SAPATGG
MW:1156.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
945 - 960 of 1,339
no targeter for Bottom