2,094  results were found

SearchResultCount:"2094"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (102996-562)
Supplier: Anaspec Inc
Description: Peptide YY (3-36), human, Purity: HPLC >/= to 95%, Molecular Weight: 4049.5, Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a Y2R agonist, is released from the gastrointestinal tract postprandially, Size: 0.5 mg


Catalog Number: (102996-558)
Supplier: Anaspec Inc
Description: Peptide YY, human, Purity: HPLC >/= to 95%, Molecular Weight: 4309.8, Sequence: YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, Appearance: Lyophilized white powder, is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (102999-354)
Supplier: Anaspec Inc
Description: [Gla17,21,24] - Osteocalcin (1 - 49), YLYQWLGAPVPYPDPL - Gla - PRR - Gla - VC - Gla - LNPDCDELADHIGFQEAYRRFYGPV (Gla=Y - Carboxyglutamic Acid, Disulfide bridge: 23 - 29), Molecular Weight: 5929.5, Storage: -20 deg C, Size: 0.1 mg


Catalog Number: (102998-094)
Supplier: Anaspec Inc
Description: SensoLyte* Anti - Rat MOG (1 - 125) IgG Quantitative ELISA Kit, Storage 4 deg C, pre-coated with recombinant human MOG (1-125) protein and pre-blocked with BSA, to detect anti-human MOG (1-125) IgG in mouse serum or cerebrospinal fluid, Size: One 96-well strip plate


Catalog Number: (102999-762)
Supplier: Anaspec Inc
Description: Biotin - ACTH (1 - 39), human, Sequence: Biotin - SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4768.4, Apperance: Powder, application: used in ELISA assays, Storage: -20 deg C, Size: 0.5 mg


Catalog Number: (103008-976)
Supplier: Anaspec Inc
Description: SensoLyte* Rh110 Matriptase Activity Assay Kit, Fluorimetric, Contains: Rh110 Matriptase substrate, Rh110 fluorescence reference standard, Matriptase, human recombinant, Assay Buffer, Leupeptin, Storage: -20 degree C, Size: 100 Assays (96-well plate)


Catalog Number: (103006-890)
Supplier: Anaspec Inc
Description: 26Rfa, Hypothalamic Peptide, rat, neuropeptide, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): ASGPLGTLAEELSSYSRRKGGFSFRF-NH2, Molecular weight: 2820.2, Physical State: Lyophilized White Powder, Storage: -20 degree C, Size: 1 mg


Catalog Number: (103010-224)
Supplier: Anaspec Inc
Description: QXL* 490 acid, Molecular Weight: 377.42, Solvent System DMSO or DMF, dyes are the optimized quenchers for EDANS, AMCA and most coumarin fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of EDANS and AMCA, Storage -20 deg C, size: 5 mg


Catalog Number: (103007-806)
Supplier: Anaspec Inc
Description: MOG (35-55), human, Sequence: MEVGWYRPPFSRVVHLYRNGK, Purity: >/= 95%, This is amino acids 92 to 106 fragment of the myelin oligodendrocyte glycoprotein, can be used to induce experimental autoimmune encephalomyelitis, Molecular Weight: 2592, Storage: -20 C, Size: 1 mg


Catalog Number: (103007-562)
Supplier: Anaspec Inc
Description: Big Endothelin-1 (1-38), human, Sequence: CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1-15 and 3-11), Purity: By HPLC >/= 95%, Big Endothelin-1 (1-38) is precursor of endothelin 1, Molecular Weight: 4283, Storage: -20 C, Size: 0.5 mg


Catalog Number: (103008-722)
Supplier: Anaspec Inc
Description: delta PKC (8-17); PKC d Inhibitor, Purity: Greater than or equal to 95% (HPLC), Molecular weight: 1116.2, Sequence: SFNSYELGSL, Appearance: Powder, derived from the V1 domain of protein kinase C (PKC)d, Storage: -20 degree C, Size: 1mg


Catalog Number: (103007-232)
Supplier: Anaspec Inc
Description: Glu - Glu epitope Tag, Sequence: EYMPME, Purity: HPLC greater than or equal to 95%, 314 to 319 amino acids fragment of the middle T antigen of mouse polymavirus, Molecular Weight: 798.9, Apperance: Powder, Storage: -20 deg C, Size: 5 mg


Catalog Number: (103009-498)
Supplier: Anaspec Inc
Description: [Lys(Ac)27]-Histone H3 (23-34), H3K27(Ac), Purity: HPLC >/= 95%, MW: 1156.3, Sequence: [KAAR-K(Ac)-SAPATGG] This is histone H3 (23-34) with acetylation at Lys27. Associated with histone deposition in replicating chromatin. Store: -20 deg C, Size: 1mg


Catalog Number: (103007-544)
Supplier: Anaspec Inc
Description: Beta-Amyloid (16-22), Human, mouse/rat, Sequence: KLVFFAE, Purity: By HPLC greater than or equal to 95%, short fragment of the b-Amyloid peptide containing two aromatic phenylalanine residues, Molecular Weight: 853, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-718)
Supplier: Anaspec Inc
Description: BDC2.5 Mimotope, Sequence: RTRPLWVRME, Purity: By HPLC greater than or equal to 95%, mimitope was used in type 1 diabetes (T1D) study, Molecular Weight: 1343.6, Storage: -20 deg C, Size: 1 mg


Catalog Number: (103007-292)
Supplier: Anaspec Inc
Description: Kinase Substrates Library, Group II, biotinylated, 18 distinct peptide mixtures, Storage: -20 deg C, Size: 1 Set


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
In order to process your orders without delay, we request that you provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • State issued document with your organization's Federal Tax ID Number
  • State issued document with your organization's Resale Tax ID Number
  • City or County issued Business License
  • State Department of Health Services License
  • Any other ID issued by the State that includes the business name and address

* Please note if your account is within the State of California two of these pieces of identification will be required.
VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
833 - 848 of 2,094
no targeter for Bottom